KEGG   Octadecabacter arcticus: OA238_c31920Help
Entry
OA238_c31920      CDS       T02539                                 

Gene name
fhs
Definition
(GenBank) formate--tetrahydrofolate ligase Fhs
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
oar  Octadecabacter arcticus
Pathway
oar00670  One carbon pool by folate
oar01100  Metabolic pathways
oar01120  Microbial metabolism in diverse environments
oar01200  Carbon metabolism
Module
oar_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:oar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    OA238_c31920 (fhs)
Enzymes [BR:oar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     OA238_c31920 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: AGI73184
UniProt: M9RKR4
Position
complement(3386251..3387927)
Genome map
AA seq 558 aa AA seqDB search
MGYKTDIEIAREANKKPIQEIGAKLGIGSDDLLPYGHDKAKVSQSFINSVQGNKNGKLIL
VTAINPTPAGEGKTTTTVGLGDGLNRIGKKAAVCIREASLGPNFGMKGGAAGGGYAQIVP
MEDMNLHFTGDFHAITSAHSLLSAMIDNHIYWGNELEIDIRRVVWRRVVDMNDRALRQIT
ASLGGVANGFPREAGFDITVASEVMAILCLSNNLKDLEKRLGDMIVAYRRDRSPVFARDI
KADGAMTVLLKDAMQPNLVQTLENNPAFVHGGPFANIAHGCNSVIATTTALKIADYVVTE
AGFGADLGAEKFMNIKCRKAGLAPDCVVLVATVRAMKMNGGVAKGDLGNEDVAAVNKGCA
NLGRHIGNLKSFGVPVVVAINHFVTDTDAEVQAVKDYVKTQGSEAILSQHWEHGSKGSEA
LATRVAEIADSGISAFAPIYPDDMKLADKIQTIAKRIYHAEEALMDQKIRDQLKLWEEQG
YGNLPVCMAKTQYSFSTDPTLRGAPTGFSVPVREVRLSAGAGFVVAVCGEIMTMPGLPRT
PSAENIHLNDDGQIEGLF
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgggttataaaaccgacatcgaaatcgcacgcgaagccaacaagaagccaatccaagag
attggcgcgaagctgggcatcggcagcgacgatttgctgccctacggccacgacaaggca
aaagtcagccagtcgttcatcaactctgttcagggcaacaaaaacggcaagctgatcctg
gtcacagcgatcaacccgacgcctgcgggcgaaggcaagacgacgacgaccgttggtctg
ggtgatgggttgaaccgcattggcaaaaaggcggctgtatgtattcgcgaagcgtcgctt
gggccaaacttcggtatgaagggtggggccgctggtggcggttacgcgcagattgtgccg
atggaagacatgaacctgcatttcaccggtgacttccacgcgatcacatctgcacattcg
ctgctgtctgctatgatcgacaaccacatctattggggcaatgagctggaaatcgacatt
cgccgcgttgtgtggcgtcgtgtcgttgacatgaacgaccgcgcgttgcgccagatcacg
gcgtccttgggcggtgtggccaacggtttcccacgtgaagcgggttttgacattactgtg
gcatccgaagttatggcgattctgtgcttgtccaataacctcaaagaccttgagaagcgc
cttggcgatatgatcgtggcttaccgccgcgaccgcagcccagtgtttgcacgcgacatc
aaagctgacggcgcgatgaccgtactgctgaaagatgcgatgcagccgaacttggtgcag
acgttggaaaacaacccggcattcgtgcatggtggcccgttcgccaacatcgcgcacggc
tgtaattcggtcatcgcgacgacaacggcgctgaagatcgccgattatgttgtgaccgaa
gcaggtttcggcgctgatttgggcgctgagaagttcatgaacatcaaatgccgcaaagcc
ggtctggcacccgattgcgtcgtgttggtcgcgacagtgcgggcgatgaaaatgaatggt
ggcgtcgcgaagggggaccttggcaatgaggacgttgcagccgtcaacaagggctgtgcc
aaccttggccgtcacatcggtaacctgaaatcctttggggttccggttgtcgtggcgatc
aaccactttgtcactgataccgacgcagaagtgcaggccgtgaaggattatgtgaagacc
caagggtcagaagcgatcctgtcccagcattgggaacatgggtccaaggggtccgaagca
ctggcaacacgcgtggctgaaattgccgatagtggcattagcgcgtttgccccgatctat
cctgatgacatgaagctggccgataagatccagaccatcgccaaacgcatctaccatgcg
gaggaggcgttgatggatcaaaaaatccgcgatcagttgaagttgtgggaagaacagggc
tacggtaacttgccggtttgtatggcgaaaacgcagtattcgttctcaacagatccgacg
ttgcgcggcgcgccaactggcttctctgtgccggtgcgcgaagtgcgtctgtctgcaggt
gcgggtttcgtggtggccgtatgtggtgagatcatgacgatgccgggcttgccgcgcaca
ccgtccgctgagaacattcacctgaatgatgatggccaaatcgaaggcttgttctag

DBGET integrated database retrieval system