KEGG   Octadecabacter arcticus: OA238_c37860Help
Entry
OA238_c37860      CDS       T02539                                 

Gene name
phaA2
Definition
(GenBank) acetyl-CoA acetyltransferase phaA
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
oar  Octadecabacter arcticus
Pathway
oar00071  Fatty acid degradation
oar00072  Synthesis and degradation of ketone bodies
oar00280  Valine, leucine and isoleucine degradation
oar00310  Lysine degradation
oar00362  Benzoate degradation
oar00380  Tryptophan metabolism
oar00620  Pyruvate metabolism
oar00630  Glyoxylate and dicarboxylate metabolism
oar00640  Propanoate metabolism
oar00650  Butanoate metabolism
oar00900  Terpenoid backbone biosynthesis
oar01100  Metabolic pathways
oar01110  Biosynthesis of secondary metabolites
oar01120  Microbial metabolism in diverse environments
oar01130  Biosynthesis of antibiotics
oar01200  Carbon metabolism
oar01212  Fatty acid metabolism
oar02020  Two-component system
Module
oar_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:oar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OA238_c37860 (phaA2)
   00630 Glyoxylate and dicarboxylate metabolism
    OA238_c37860 (phaA2)
   00640 Propanoate metabolism
    OA238_c37860 (phaA2)
   00650 Butanoate metabolism
    OA238_c37860 (phaA2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OA238_c37860 (phaA2)
   00072 Synthesis and degradation of ketone bodies
    OA238_c37860 (phaA2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OA238_c37860 (phaA2)
   00310 Lysine degradation
    OA238_c37860 (phaA2)
   00380 Tryptophan metabolism
    OA238_c37860 (phaA2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OA238_c37860 (phaA2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OA238_c37860 (phaA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OA238_c37860 (phaA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oar04147]
    OA238_c37860 (phaA2)
Enzymes [BR:oar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OA238_c37860 (phaA2)
Exosome [BR:oar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OA238_c37860 (phaA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C Cluap1
Motif
Other DBs
NCBI-ProteinID: AGI73735
UniProt: M9RV44
Position
complement(4021658..4022833)
Genome map
AA seq 391 aa AA seqDB search
MTNVVIASAARTAVGSFGGAFANTPAHDLGAAVLEEVVARAGIDKSEVSETILGQVLTAA
QGQNPARQAHINAGLAKEAAAWSLNQVCGSGLRAVALGAQHIMLGDASIVAAGGQENMTL
SPHAQNMRAGQKMGDMQLIDTMIRDGLWDAFNQYHMGQTAENVAEQWQISRDMQDEFAVA
SQNKAEAAQKAGKFADEIAAFTVKTRKGDIIVDQDEYIRHGATMEAMQKMRPAFMKDGTV
TAANASGLNDGAAATILMSADEAEKRGIEPLARIASYATAGLDPSIMGVGPIYASRKALD
KAGWSVDDLDLVEANEAFAAQACAVNKEMGWDPAIVNVNGGAIAIGHPIGASGCRVLNTL
LFEMKRRGAKKGLATLCIGGGMGVALCVERP
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgtagttatcgcatccgcagcccgtaccgctgtgggcagctttggtggcgca
tttgccaacacgcccgcacatgatttgggtgcggccgttctggaagaagtcgtcgcccgt
gccggaatcgacaaatctgaagtgtcggaaaccattctgggtcaggttttaaccgcggcg
cagggccagaaccccgcgcgtcaggcgcatatcaatgccggattggccaaagaagccgca
gcatggtcgctcaatcaggtctgtggatccggtcttcgtgctgttgcgctgggcgcgcag
catatcatgcttggtgatgcgtcgattgtggccgctggtggtcaggaaaacatgacactt
tcgccccacgcgcaaaacatgcgcgccggtcagaagatgggcgacatgcagttgatcgac
accatgatccgtgatggactttgggacgcgttcaaccagtaccacatgggacaaactgcc
gaaaacgttgcagagcagtggcagatttcgcgcgacatgcaggatgaattcgccgtcgcg
tcccagaacaaagccgaagcggcccaaaaggctggcaagttcgccgatgagattgcagcg
ttcaccgtgaagacccgcaagggcgacatcattgttgatcaagacgaatacatccgccac
ggcgcgacgatggaagccatgcaaaaaatgcgtccggccttcatgaaagacggcaccgtg
acagcggccaacgcttccggtctgaacgacggtgcggcggcaacaatactgatgtctgcg
gatgaggctgaaaaacgcgggattgagcctttggcccgcatcgcatcctacgcgacagct
ggtttggacccgtcaatcatgggcgtcggcccgatctatgcatcgcgcaaggcgctggat
aaggcgggctggtccgtggatgatctggaccttgttgaagccaacgaagccttcgcagcg
caagcctgtgccgtgaacaaagaaatgggctgggatccggcaattgtgaacgtgaacggc
ggcgcgattgcgattggccacccgatcggtgcgtccggttgccgcgttttgaacacgctg
ttgtttgaaatgaagcgtcgtggtgccaaaaaaggcctcgcgacgttgtgcatcggtggc
ggtatgggtgtcgcgctgtgtgttgagcgtccttaa

DBGET integrated database retrieval system