KEGG   Ovis aries (sheep): 100037702
Entry
100037702         CDS       T03117                                 

Gene name
TM7SF2
Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
oas  Ovis aries (sheep)
Pathway
oas00100  Steroid biosynthesis
oas01100  Metabolic pathways
Module
oas_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    100037702 (TM7SF2)
Enzymes [BR:oas01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     100037702 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 100037702
NCBI-ProteinID: XP_014958663
Ensembl: ENSOARG00000012581
UniProt: A0A6P3YSD3
Position
21
AA seq 431 aa
MPREPWIWKGACGGQGEPESGPPDGSPPSPGAAALMLLLPVTMFHLLLVARSGPARLLGP
PPYLPGLEELWSPWALLLCLTWLGLQAALYLLPARKVAEGQELKDKSRLRYPINGFQALV
LTALLVGLGVSAGLPLSALPEMLLPLAFAATLTAFIFSLLLYLKALVAPASALAPGGNSG
NLIYDFFLGRELNPRICSFDFKYFCELRPGLIGWVLINLALLMQEAELRGSPSLAMWLVN
GFQLLYVADALWYEEAVLTTMDIIHDGFGFMLAFGDLAWVPFTYSLQAQFLLYHPQPLGW
PLASFICLINAVGYYIFRGANSQKNTFRKNPSDPRVADLETISTATGRRLLVSGWWGMVR
HPNYLGDLIMALAWSLPCGVFHLLPYFYFLYFTALLVHREDRDERQCLQKYGLAWHEYCQ
RVPYRIVPYVY
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgccgagggagccctggatatggaaaggtgcctgtgggggtcagggagagccggagagc
ggacccccagacggatcgccgccttccccaggcgccgcggcgctgatgctgctgctcccg
gtcactatgttccacctgctactggtggcccgctcgggaccggcgcgccttctaggccca
cccccctacctgccgggactggaggagctgtggagcccgtgggcgctgttgctctgtctc
acctggctcggcctgcaggcggcgctctacctcttgccggcgcgcaaggtggctgagggg
caggaattgaaggacaagagtcgactgcgctaccccattaacggcttccaggccctggtg
ctgacagccctcctggtgggcctgggggtgtcagccgggctgcccctgagcgcgctcccg
gaaatgctcttgcccttggcatttgcggccaccctcaccgccttcatcttcagcctcctt
ctgtatctgaaggctttggtagcccctgcctcggccctggcacctggagggaactcaggc
aatctcatctacgacttcttcctgggacgggagctcaacccgcgcatctgttcctttgac
ttcaaatatttctgcgaactgcggcctggcctcatcggctgggtcctcatcaacctggcc
ttgctgatgcaggaagcagaacttcgggggagtccctcactggccatgtggctggtcaat
ggcttccagctactgtatgtggctgatgccctttggtacgaggaggcagtcctgaccacc
atggacatcatccatgacgggtttggcttcatgctggcctttggggaccttgcctgggta
cccttcacctacagcctgcaggcccagttcctgctgtatcacccacagcctctggggtgg
cccctggcctcattcatctgcctcatcaatgctgttggttactacatcttccgtggagcc
aattctcagaaaaataccttccgaaagaatccttctgatcccagagtggctgaccttgag
accatctctacagccacagggcgacggctgctggtgtctgggtggtggggtatggtccgc
catcccaactaccttggagacctcatcatggctctggcctggtccttgccgtgtggggtg
ttccacctgttgccctacttctacttcctctacttcactgcgctgctggtgcaccgtgag
gaccgggatgagcggcagtgtctgcagaagtacggcctagcctggcacgaatactgccag
cgtgtgccctaccgaatcgtgccctacgtctactga

DBGET integrated database retrieval system