KEGG   Ovis aries (sheep): 100126575Help
Entry
100126575         CDS       T03117                                 

Gene name
CTTNBP2
Definition
(RefSeq) cortactin-binding protein 2
Organism
oas  Ovis aries (sheep)
SSDB OrthologParalogGFIT
Motif
Pfam: CortBP2 Ank_4 Ank_2 Ank Ank_5 Ank_3
Motif
Other DBs
NCBI-GeneID: 100126575
NCBI-ProteinID: NP_001182240
Ensembl: ENSOARG00000010183
UniProt: Q09YI1
Position
4
AA seq 1641 aa AA seqDB search
MATDGASCEPDFSRAPEDAAGAPAEAAKKEFDVDTLSKSELRMLLSVMEGELEARDLVIE
ALRARRKEVFIQERYGRFNLNDPFLALQRDYEAGASDKEKKPVCTNPLSILEAVMAHCRK
MQERMSTQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEERGKNKHVVLMLVKECKQ
LSGKVLEEAQKLEEVMAKLEEEKKKTSALEEELATEKRRSAEMEAQMEKQLSEFDTEREQ
LRAKLHREEAHTTDLKEEIDKMKKMIEQLKRGNDSKPSLSLPRKTKDRRLVSISVATEGP
MTRSVACQTDLVTETAEPLKKLPLTVPVKPAAGSPLVSASAKGNACASAASVRPGIERQV
SHGDLIGSSLPTVPPPSTDRIEENGPSTGSTPDLTSSPTALPSTVSPASGHTPTPPPHSL
HSPCANAPLHPGLNPRIQAARFRFQGSNANDPDQNGNTTQSPPSRDVSPTSRDTLVAKQL
ARNTVTQALSRFTSPPAGAPPRPGAPPTGDVGTYPPVGRTSLKTPGGARVDRGNPPPIPP
KKPGLSQTPSPPHPQLKVIMDSSRASSTGIKADNKTVASSPSSLPQGNRVINEENLSKSS
SPQLPPKPSIDLTVAPAGCAVSALATSQVGAWPAETPGLNQPACSESSLVIPTTTAFRSS
INPVSASSRRAGASDSLLVTASGWSPSLTPLLMSGGPAPLAGRPTLLQQAAAQGNVTLLS
MLLNEEGLDINYSCEDGHSALYSAAKNGHTDCVRLLLNAEAQVNAADKNGFTPLCAAAAQ
GHFKCVELLIAYDANINHAADGGQTPLYLACKNGNKECIKLLLEAGTDRSVKTRDGWTPI
HAAVDTGNVDSLKLLMYHGAPAHGNKLQEEPGLAIFDLDQEEHHEGTSKPVVPADLINHA
DSEGWTAAHIAASKGFKNCLEVLCRHGGLEPERRDKCNRTAHDVATDDCKHLLENLNALK
IPLRISVGEIEPGNYGADDFECENTICALNIRKQTSWDDFSKAVSQALTNHFQAISSDGW
WSLEDMTFNSTTDSSIGLSASSVRSITLGSVPWSAGQSFTQSPWDFMRTNKAEQVTVLLS
GPQEGCLSSVTYASMIPLQMLQNYLRLVEQYHNVIFHGPEGSLQDYIAHQLALCLKHRQM
AAGFPCEIVRAEVDADFSKEQLVDLFISSACLIPVKQSPANKKIIIILENLEKSSLSELL
GDFLGPLENHSTESPCTFQKGNGMSECYYFHENCFLMGTIAKACLQGSDLLVQQHFRWVQ
LRWDSEPMQGLLQRFLRRKVVNKFRGQVPSPCDPVCKTVDWALAVWRQLNSCLARLGTPE
ALLGPKYFLSCPVIPGHAQATVKWMSKLWNAVIAPRVQEAILSRASVKRQPGLGQTTKNP
SQGQQAVVRAALSILLNKAVLHGCPLQRAELDQHTADFKGGSFPLSIVSSYSSCSKKRES
GAWRKVSTSPRKKSGRFSSPTWNKPDLSEEGIKSNTILQLNCNRNASLSNQKSLENDLSL
TLNLDQRLSLGSDDEADLVKELQSMCSSKSESDISKIADSRDDLRRFDSSGNNPVFSATV
NNPRMPVSQKEVSPLSSHQMTERSNSKSKTESGVSRVKSFLPVPRSKVTQCSQNTKRSSS
SSNTRQIEINNNSRDLEPTQK
NT seq 4926 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggacggcgcgagctgcgagcccgacttctcccgcgcccccgaggacgcggcc
ggggccccggcggaggcggcgaaaaaagagtttgatgtggataccctcagtaaatcagag
cttcggatgctcctcagtgtgatggaaggggagctggaggccagagacctcgtcatcgag
gccctgcgggctcgcaggaaggaggtatttatccaggaacggtatgggagatttaattta
aatgacccattcctggcactacagagagactatgaagcaggtgccagcgataaagagaag
aagccagtttgtaccaaccccctctccatcctcgaagcagtcatggcacactgcagaaaa
atgcaagaaaggatgtccacacagctggctgctgctgagagcagacaaaagaagctggag
atggaaaagcttcagctccaagcacttgagcaggagcacaagaagttggctgcccgcctg
gaggaggagcgaggcaagaataagcacgtggtcctgatgctggtcaaggagtgcaagcag
ctctctgggaaagtcctagaggaggcccagaagctggaagaggtgatggccaaactggaa
gaggagaagaaaaagacaagcgcgttagaggaggaactcgccacggagaaacgaagaagc
gcagaaatggaagctcagatggaaaagcaactctcggagtttgacacggagcgggaacag
cttcgtgccaagctgcaccgagaagaagcacacacgactgacctcaaagaggagatagac
aagatgaagaagatgatcgagcagctgaaaaggggaaatgacagcaaacccagcctctcc
ctcccccggaagacgaaagatagacgtttggtctccatatctgtggcaacagaaggacca
atgacaagatcggttgcgtgccagaccgacctagtgacagagactgctgagcccttgaag
aagttgcctttgaccgtgcccgtaaagcctgccgcggggagccccctagtctccgccagt
gccaaggggaatgcctgcgccagtgccgcctcggtcagaccgggtatcgagaggcaggtt
tcccacggtgacttgataggctcctctctgcccactgtcccacctccaagtacagacaga
attgaggaaaatggaccaagcaccggctcaacaccagatttaaccagtagcccaaccgca
ctacccagtacagtttccccggcctccgggcacacgcccaccccgcctccgcacagttta
cattcaccgtgtgccaacgcgcctctgcatccgggtctgaacccacgcatccaagcggct
cgatttcgatttcaaggcagtaatgctaatgacccagaccaaaacggaaacaccacccaa
agccctccatccagagatgtctctcctacaagtcgtgacaccctagtggccaaacagctt
gctcggaatactgtgacccaagcactgtcgagatttacaagccccccggcgggagcgccc
ccgagacctggcgcgccccccacgggggacgttggcacctaccccccggtcggtcgaacc
agtttaaagactcctggtggggcccgagttgacagaggaaaccctcctcccatccctcca
aaaaagccagggctctcccaaactccttctccaccgcacccccaactcaaggttatcatg
gatagcagcagggcctccagcacagggatcaaagccgataacaaaactgtggcttcgtct
ccttccagtttgccacaagggaacagggtaataaatgaggagaatctctctaaatcttcc
tcccctcagctgccaccaaaaccatccatagatttaactgtggcacccgcaggctgtgcc
gtttcagccctggccacatctcaggtgggtgcctggcctgctgaaacccctggactgaac
caacctgcatgttcagaaagctcccttgtcattcccaccaccactgcctttcgctcttcc
ataaaccctgttagtgcctcatcccgtagagcaggtgcctctgacagcctcctggtaaca
gcatcaggctggtcaccctccctaacccctttgctaatgagtggtggtcctgcccccctg
gctggcaggcccacccttcttcagcaagctgctgcccagggaaatgtcactttattatca
atgctgcttaatgaagaaggactggacattaattactcctgtgaagatggccattctgcc
ttgtattctgctgctaagaatggacatacagactgtgtgagattgctgctgaatgcagaa
gcccaagtcaatgctgctgataaaaatggcttcacacccttgtgtgctgcagctgctcag
ggacatttcaagtgtgtagaattattaattgcatatgatgctaatattaatcatgctgct
gatggaggacagacacctctatacctggcctgtaaaaatggaaataaagaatgtattaaa
ctcttgttggaagctggaactgaccgaagtgtaaaaaccagagatggctggacaccaatt
catgcagccgtggacactggtaatgtggacagcctcaagcttcttatgtaccatggagcc
ccagctcatggaaacaagttgcaggaggagcctgggttggccatctttgacctggatcaa
gaagagcatcatgaaggcacatccaagcctgttgttcctgcagacctcatcaaccatgct
gacagtgaaggctggactgctgcccatattgctgcttcaaagggttttaagaactgccta
gaagtcttgtgtaggcacggagggctggagccggaaagaagagataagtgtaaccggacc
gcacacgatgttgctactgatgactgcaagcacctgctggagaatctgaatgctcttaaa
atacccttaaggatttcagtgggtgaaatcgaaccaggcaactacggtgccgatgacttt
gaatgtgaaaacacaatatgtgctttaaatattcgcaaacagacatcctgggatgatttt
tcaaaagcagtgagtcaagctctgacaaaccatttccaagcaatctcttctgatggatgg
tggagcctggaagacatgacgtttaatagcaccaccgactccagcattggcctcagtgca
agcagtgtgcgatccatcacattaggaagtgtgccgtggtcagcgggtcagagcttcacc
cagtccccatgggacttcatgagaacgaataaagcagagcaggtcactgtgcttctgtca
gggcctcaggagggctgcctcagtagtgtgacctacgcgtctatgatccctcttcagatg
ctgcagaactacctcagactggtcgagcaatatcataatgtcattttccacggcccagag
gggagcttgcaagactacatcgcccatcagcttgcactctgcctgaagcacagacaaatg
gctgcaggattcccctgtgaaatagtgagagccgaagtggatgctgatttctccaaggaa
cagctagtagatctgttcatcagtagcgcatgtctgatcccagtgaaacaatctcctgct
aacaagaaaatcatcatcatcttagagaacttggaaaaatcttcattgtctgagttactg
ggggactttttgggacctctggaaaatcacagcactgaaagcccctgtaccttccaaaaa
ggaaacggaatgtctgaatgctactactttcatgagaactgctttctgatgggaacaatc
gccaaggcctgtctgcagggctccgacttgctggtgcagcagcatttccgctgggtgcag
ctgcgctgggacagcgagcccatgcaggggctgctgcagaggttcctcaggaggaaggtt
gtgaataagttcagaggtcaggtgccctctccctgcgaccccgtgtgcaagacggtcgac
tgggccctggctgtgtggcgccagctcaactcgtgcctggcccgcctgggcacaccggaa
gcactcctcgggccaaagtatttcctgtcttgtcctgtaatcccagggcacgcccaagca
acagtgaagtggatgtctaagctatggaatgctgtcattgcacccagagttcaagaagca
atattgtcaagagcctctgtgaaaagacaacctggccttgggcaaacaactaaaaaccct
agccaagggcagcaggctgtggttagagctgctctcagcattttgcttaataaagctgtt
ctgcatggctgtcccctccagagagcagagctggaccagcatacagctgatttcaaagga
ggaagcttccctctgtccatagtttcaagttacagcagttgcagcaagaagagagagagt
ggcgcctggagaaaggtgagcaccagtcctcgcaagaagtccggccggttctcgtcaccc
acctggaacaagccagacttgagtgaagaaggtatcaaaagtaacactatattacagctg
aattgtaacaggaatgcttcgctgtcaaaccaaaagtctttagagaatgatctgtcattg
acattgaatctggatcaaagactgtctctgggttcggatgatgaagcagatcttgtcaag
gaacttcagagcatgtgctctagcaaatctgaatctgatataagcaagattgctgattcc
agggatgacttaaggaggtttgatagttcaggaaacaaccctgtgttttcagcaactgtt
aataatccaagaatgccagtgtcacaaaaggaggtcagtcctctcagcagccatcaaatg
accgaacgcagcaacagtaaatcaaagactgagtcgggtgtttcaagagttaaatctttt
cttcctgttcctagaagtaaagtcacccagtgttcccagaacaccaaaagaagcagcagc
agcagtaatacaaggcaaatagaaataaacaacaactcaagagatttggaacctacgcaa
aaatga

DBGET integrated database retrieval system