KEGG   Ovis aries (sheep): 100127211Help
Entry
100127211         CDS       T03117                                 

Gene name
CAPN2
Definition
(RefSeq) calpain-2 catalytic subunit
  KO
K03853  calpain-2 [EC:3.4.22.53]
Organism
oas  Ovis aries (sheep)
Pathway
oas04141  Protein processing in endoplasmic reticulum
oas04210  Apoptosis
oas04217  Necroptosis
oas04218  Cellular senescence
oas04510  Focal adhesion
oas05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100127211 (CAPN2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100127211 (CAPN2)
   04217 Necroptosis
    100127211 (CAPN2)
   04218 Cellular senescence
    100127211 (CAPN2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100127211 (CAPN2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100127211 (CAPN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oas01002]
    100127211 (CAPN2)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.53  calpain-2
     100127211 (CAPN2)
Peptidases and inhibitors [BR:oas01002]
 Cysteine peptidases
  Family C2: calpain family
   100127211 (CAPN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_7
Motif
Other DBs
NCBI-GeneID: 100127211
NCBI-ProteinID: NP_001106288
Ensembl: ENSOARG00000015097
UniProt: A8IF71
Position
12
AA seq 700 aa AA seqDB search
MAGIAAKLAKDREAAEGLGSHERAVKYLNQDYAALRDECLEAGALFQDPSFPALPSSLGF
KELGPYSSKTRGIEWKRPTEICDDPQFITGGATRTDICQGALGDCWLLAAIASLTLNEEI
LARVVPLDQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSAL
LEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYELRKAPPNLFRIIQKALQKGSLLGC
SIDITSAADSEAITFQKLVKGHAYSVTGAEEVESRGSLQKLIRIRNPWGEVEWTGQWNDN
CPNWNTVDPEVRESLTRRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTSDTYKKWKLTK
MDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDQEDGESGCTFLVGLIQKHRRRQR
KMGEDMHTIGFGIYEVPEEFTGQTNIHLSKKFFLTTRARERSDTFINLREVLNRFKLPPG
EYIVVPSTFEPNKDGDFCIRVFSEKKADYQVVDDEIEANLEEIDISEDDIDDGFRRLFAQ
LAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYIL
WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEAAGFKMPCQLHQVIVARFADDDLIIDFD
NFVRCLIRLETLFRIFKQLDPENTGMIQLDLISWLCFSVL
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcatcgcggccaagctggccaaggaccgggaggcggccgaggggctgggctcg
cacgagagggcggtcaagtacctcaaccaggactacgcggcgctgcgggacgagtgcctg
gaggccggggcgctgttccaggacccctccttcccggccctgccttcctccctgggcttc
aaggagttgggaccctactccagcaagacccggggcatcgagtggaagcggcccacggag
atctgcgatgatccccaatttattactggaggagccactcgcacagacatctgccaagga
gccctaggtgactgctggctgctggccgccattgcctccctcactttgaatgaagaaatt
ctggctcgagtcgtccccctggaccagagcttccaggagaactatgcagggatcttccac
ttccagttctggcagtacggcgagtgggtggaggtggtggtggacgacaggctgcccacc
aaggacggggagctgctcttcgtgcactcagcagagggcagcgagttctggagtgcgctg
ctggagaaggcctacgccaagatcaatgggtgttatgaagcactttcggggggcgccacc
accgagggcttcgaggacttcactggaggcatcgccgagtggtatgagttgaggaaggcc
cctcccaacctgttcaggatcatccagaaggctctgcagaaaggctctctcctgggctgc
tccatcgatatcaccagcgcggcggactcggaggccatcacgttccagaagctggtgaag
gggcacgcgtactcggtgaccggcgccgaggaggtggaaagcagaggaagcctgcagaag
ctgatccgcatccggaatccctggggagaggtggagtggaccgggcagtggaatgacaac
tgcccaaactggaacacagttgaccccgaggtgagggaaagcctgaccagacggcacgag
gatggggaattctggatgtctttcagcgacttcctgagacactattcccgcctggagatc
tgcaacctaacccctgatacactcaccagtgacacctacaagaagtggaaactcaccaag
atggatgggaactggaggcgaggctcgaccgcgggcggctgcaggaactacccaaacacg
ttctggatgaaccctcagtacctgatcaagctggaggaagaggacgaggatcaggaggac
ggggagagcggctgcaccttcctggtgggcctcatccagaagcaccgccggcggcagaga
aagatgggcgaggacatgcacaccattggctttggcatctatgaggttccagaggagttt
actgggcagaccaacatccacctcagcaaaaaattcttcctgacaaccagagcgcgggag
cggtcggacaccttcatcaacctgcgggaggtgctcaaccgcttcaagctgccccccggg
gagtacatcgtggtgccctccaccttcgagcccaacaaggacggcgacttctgcatccgg
gtcttttctgagaagaaagccgactaccaagttgtcgacgatgaaatcgaggccaacctt
gaggagattgacatcagcgaggacgacatcgatgatggattcaggagactgtttgcccag
ctagctggagaggatgcagagatttctgcctttgagttgcagacaatcctgagacgagtg
ctagcaaagcgccaagatatcaagtccgacggcttcagtattgagacctgcaagatcatg
gtggacatgctcgactcggatgggagtggcaaactgggtctgaaggagttctacattctc
tggacgaagattcagaaataccaaaaaatttaccgggaaatcgatgtggaccggtctgga
accatgaactcctatgagatgcggaaagcattagaagcagcaggtttcaagatgccctgt
cagctccaccaagtgatcgtcgcccggtttgcagatgatgacctcatcatcgattttgac
aattttgtccggtgtttgattcgactggagacactattcaggatatttaagcagctggac
ccggagaatactggaatgatccagctcgatcttatctcttggctgtgtttttcagtactt
tga

DBGET integrated database retrieval system