KEGG   Ovis aries (sheep): 101102354Help
Entry
101102354         CDS       T03117                                 

Gene name
NIT1
Definition
(RefSeq) deaminated glutathione amidase isoform X1
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
oas  Ovis aries (sheep)
Brite
KEGG Orthology (KO) [BR:oas00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101102354 (NIT1)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     101102354 (NIT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase DUF1643
Motif
Other DBs
NCBI-GeneID: 101102354
NCBI-ProteinID: XP_004002732
Position
1
AA seq 328 aa AA seqDB search
MLGFIIRPPHQLLSLLSCPGLRIPRFSVLCAPLRLRTMAVSSSSWELPLVAVCQVTSTPD
KEQNFKTCAELIREAARLGACLAFLPEAFDFIARDPEETQRLSEPLGGNLLEEYTQLARE
CGLWLSLGGFHERGQDWEQTQKIYNCHVILNNMGSVVATYRKTHLCDVEIPGQGPMRESN
STIPGPSLESPISTPAGKIGLAICYDMRFPELSLALVQAGAEILTYPSAFGSVTGPAHWE
VLLRARAIETQCYVVAAAQCGRHHEKRASYGHSMVVDPWGTVVARCSEGPGLCLARIDLN
YLQQLRKQLPVFQHRRPDLYGNLGHPLS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcttcatcatcaggcctcctcaccaactcctgtcccttctttcgtgtcctgga
ctccggatacctcgattttcagtactttgtgctccactcagactcagaactatggccgtc
tcatcttcttcctgggaactgcccctggtggctgtgtgccaggtaacatcgaccccagac
aaggagcagaactttaaaacatgtgctgagctgattcgggaggctgccaggctgggcgct
tgcctggctttcctgcctgaggcatttgacttcattgcacgggaccctgaagagacacaa
cgcctgtctgagccactgggtgggaaccttttggaagaatatacccagcttgccagggaa
tgtggactctggctgtccttgggtggtttccatgagcgtggccaggactgggagcagact
cagaaaatctacaactgtcatgtgattctgaacaacatggggtcagtagtggccacctac
aggaagacgcatctgtgtgatgtagagattccaggacaggggcctatgcgtgaaagcaac
tctaccatacctgggcccagtcttgagtctcctatcagcacaccagcaggcaagattggt
ctagctatctgctatgacatgcggttccctgaactctctctggcattggttcaggcagga
gcagaaatacttacctacccttcggcttttggatctgttacaggcccagcccattgggag
gtgttgttgcgggcccgtgccattgaaacccagtgctacgtagtggcggcagcacagtgt
ggacgccaccatgagaagagagccagttatggacatagcatggtggtagatccctgggga
acagtggtggcccgctgctccgaaggaccaggcctttgccttgcccgaattgacctcaac
tatctgcagcagttacgcaaacaactgcctgtgttccagcaccgcaggcctgacctctac
ggcaatctgggtcacccactgtcttaa

DBGET integrated database retrieval system