KEGG   Ovis aries (sheep): 101102636
Entry
101102636         CDS       T03117                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
oas  Ovis aries (sheep)
Brite
KEGG Orthology (KO) [BR:oas00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    101102636 (ANKRD53)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    101102636 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank Ank_3 Ank_4
Other DBs
NCBI-GeneID: 101102636
NCBI-ProteinID: XP_004007354
Ensembl: ENSOARG00000011333
UniProt: W5PNW8
Position
3
AA seq 536 aa
MPSLQDAGAAAGGNQLVGDPAREAPRSRPSTTTLVLERLPASARSASWHFVRWAAAPIRR
RYLSGDVHLQLGKKGSTTRKESAVRRRSSMSLTEEWEQRAIGGSYYELFAASLGNLEWLR
FCLNRHCGEIVADDKGFTAIHFAAQSGKLACLQVLVEEYKFPVNLPTNNGQTPLHLVIHG
DNKTMALPCIHYLIKQGAALNTQTCNGSTPLHLAAREGLLSCVKVLVQKGANVHAQDATG
CKPIDYCKIWNHRVCARFLKDAMWKRDKKDFAHEMRKLRRLKDQLALMEEDYLTEYQKEH
QILREADFKKWLHHKLLLQDQSLIPSAQREPRAPPRATALSKTCKDGVLWPPTSFHPSPE
ARLQQIQQPNLPLVRPAPTYKPPTVRRPKVWNLSSNPARSPTAQIGYPQGVRLGVHPDPR
PERDFRCFVEVRSNGHGGADLRTVAGRQVAPVPQLPFQVVIRELYPSVRPYRMKVPQGFC
SVTMEEVPRKRHLGDGSFWTDTLSMNLRETFDEAFLAAVRAHQGLPALPSPKPPLP
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgccgagtctccaggacgcgggggccgcggcggggggtaaccagctggtcggtgacccg
gccagggaggcgcccaggtcccgcccctccaccacgaccctagtcctggagcgcctgccg
gcctccgcccgtagcgcgagctggcatttcgtcaggtgggcggcggcacctatcaggcgg
cggtacctctccggcgacgtacacctgcaactggggaagaagggctcaaccacccgcaaa
gagtcggcggtccggcggcgcagttccatgagtctaaccgaggagtgggaacagagggcg
atcggaggaagctactacgagctgttcgccgcctcattgggcaacctggaatggttgcgg
ttctgtctaaatcggcattgtggcgaaatcgtggccgatgacaagggtttcactgccatc
cactttgcagcccagagcggcaagcttgcatgcctgcaggtcttggtggaggagtacaag
tttcccgtaaacctgcccaccaacaatggccagacacctctgcaccttgtcatccatggt
gacaacaagaccatggccctcccctgcattcactatctgattaagcaaggggcggccctc
aacactcagacgtgcaatggctccacacctctgcatctggcagcccgcgagggcctgctg
agctgtgtcaaagtcctggtgcagaaaggtgccaacgtccacgcacaagatgccacaggc
tgcaagcccattgactactgcaaaatatggaaccaccgagtctgtgcccggttcttgaaa
gatgccatgtggaagcgggacaagaaggactttgcccatgagatgaggaaactgaggagg
ctcaaggaccagctggccctcatggaggaggactacctgactgagtatcaaaaggagcac
caaattctgagagaagctgacttcaagaagtggctccatcacaagttgctactccaagac
cagtccctaatacccagcgctcagcgagagccccgtgctccgccccgggccactgccctc
tccaagacctgcaaggacggggtactgtggcctcccacgagcttccacccctccccggag
gcgcgcctgcaacagatacagcagcccaatctgcccttggtgaggcctgcgcccacctac
aagccgcccacggtcaggcggcccaaggtgtggaatcttagcagcaaccccgccaggtcc
cccactgcccagattggctacccacagggtgtccgcctgggcgtgcatcccgaccccagg
ccagagcgcgacttccgctgcttcgtggaggtgaggtccaacgggcacggtggcgcggac
ctccgcacagtggccggccgccaggtggcgcctgtgccccagctgcctttccaagtggta
atccgcgagctgtacccttcggtaaggccctacagaatgaaggtgccccagggcttctgc
tctgtcactatggaagaggtgccccggaagcggcacttgggtgacggcagcttctggacc
gacacgctgagcatgaacctgcgagagacattcgacgaggccttcctggcagctgtgcga
gcccatcaaggactccctgctctgccttcccctaaaccacccctcccttaa

DBGET integrated database retrieval system