KEGG   Ovis aries (sheep): 101103928Help
Entry
101103928         CDS       T03117                                 

Gene name
ADSSL1
Definition
(RefSeq) adenylosuccinate synthetase isozyme 1 isoform X1
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
oas  Ovis aries (sheep)
Pathway
oas00230  Purine metabolism
oas00250  Alanine, aspartate and glutamate metabolism
oas01100  Metabolic pathways
Module
oas_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101103928 (ADSSL1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101103928 (ADSSL1)
Enzymes [BR:oas01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     101103928 (ADSSL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adenylsucc_synt hSac2
Motif
Other DBs
NCBI-GeneID: 101103928
NCBI-ProteinID: XP_027813267
Position
18
AA seq 484 aa AA seqDB search
MSGTRASNDRPPSAGGVKRGRLQHEAATTGSRVTVVLGAQWGDEGKGKVVDLLATDADII
SRCQGGNNAGHTVVVDGKEYDFHLLPSGIINPKAVSFIGNGVVVHLPGLFEEAEKNEKKG
LKDWEKRLIISDRAHLVFDFHQAVDGLQEVQRQAQEGKNIGTTRKGIGPAYSSKAARTGL
RICDLLSDFDEFSSRFKNLAHQHQSMFPSLEVDIEGQLKRLKGFAERIRPMVRDGVYFMY
EALHGPPKKILVEGANAALLDLDFGTYPFVTSSNCTVGGVCTGLGIPPQNIGEVYGVVKA
YTTRVGIGAFPTEQINEIGDLLQSRGHEWGVTTGRKRRCGWLDLMILRYAHMVNGFTAWV
AGLDEAGHPGRPGRDQGWRGVQARREADPLLPSQPGGPAEGGGGIRDAAGVEGGHHGRPE
VGGPAPAGPELHSFRGEPRRSGSEMGWCRQVQRFDDPAVLDKAGADPSGVAHVVSFPWPA
EPTP
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggacccgagcctctaacgatcggccccccagcgcgggcggcgtcaagcggggg
cggctgcagcacgaggcggcgaccaccggctcccgggtgactgtggtgctgggcgcgcag
tggggggacgagggcaaaggcaaggtggtggacctgctggccacggacgccgacatcatc
agccgctgccagggaggcaacaatgctggccacaccgtggtggtggacggcaaggagtat
gacttccacctgctgcccagcggcatcatcaaccccaaggccgtgtccttcatcggcaat
ggagtggttgtccacttgccgggcttgtttgaagaagcagagaagaacgagaagaaaggc
ctgaaggactgggagaagaggctcatcatctctgaccgggcccacctcgtgttcgacttt
caccaggcggtggacgggctccaggaggtgcagcggcaggcccaggagggcaagaacatc
ggcaccacccggaaggggatcgggccggcctactcgtccaaggccgcccgcactggcctc
cgcatctgcgacctcctgtccgacttcgacgagttctcctcccgattcaagaacctggca
caccagcaccagtccatgttccccagtttggaagtggacattgaaggtcaactcaaaagg
ctcaagggcttcgccgagcggatccgccccatggtccgagacggcgtgtatttcatgtac
gaggcgctccacggcccccccaagaagatcctcgtggagggcgccaatgcagccctcctt
gaccttgacttcgggacctaccccttcgtgacgtcctccaactgcacggtaggcggtgtg
tgcactggcctgggcatcccgccccagaacataggtgaggtctacggcgtggtcaaggcc
tacaccacacgcgtgggcatcggcgccttccccaccgagcagatcaacgagatcggggac
ctgctgcagagccgcggccacgagtggggcgtgaccacgggcaggaagcggcgctgtggc
tggctggacctcatgatcctgagatacgcccacatggtcaacggattcaccgcgtgggtg
gctggccttgacgaagctggacatcctggacgccctggacgagatcaaggttggcgtggc
gtacaagctcggcgggaagcggatcccctacttcccagccaaccaggaggtcctgcagaa
ggtggaggtggaatacgagacgctgccggggtggaaggcggacaccacggccgcccggaa
gtgggaggacctgcccccgcaggcccagagctacattcgtttcgtggagaaccgcgtcgg
agtggcagtgaaatgggttggtgtcggcaagtccagagattcgatgatccagctgtttta
gacaaagccggagctgaccccagcggcgtggcccacgtcgtgtcctttccttggccggca
gaaccaacgccgtga

DBGET integrated database retrieval system