KEGG   Ovis aries (sheep): 101105263Help
Entry
101105263         CDS       T03117                                 

Gene name
SPHK1
Definition
(RefSeq) sphingosine kinase 1 isoform X1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
oas  Ovis aries (sheep)
Pathway
oas00600  Sphingolipid metabolism
oas01100  Metabolic pathways
oas04020  Calcium signaling pathway
oas04071  Sphingolipid signaling pathway
oas04072  Phospholipase D signaling pathway
oas04370  VEGF signaling pathway
oas04371  Apelin signaling pathway
oas04666  Fc gamma R-mediated phagocytosis
oas05152  Tuberculosis
Module
oas_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    101105263 (SPHK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101105263 (SPHK1)
   04371 Apelin signaling pathway
    101105263 (SPHK1)
   04020 Calcium signaling pathway
    101105263 (SPHK1)
   04072 Phospholipase D signaling pathway
    101105263 (SPHK1)
   04071 Sphingolipid signaling pathway
    101105263 (SPHK1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101105263 (SPHK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101105263 (SPHK1)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     101105263 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 101105263
NCBI-ProteinID: XP_027829925
Position
11
AA seq 484 aa AA seqDB search
MPVRATPRAWSQNLTGRPPPQGAAPDSTSAVSSPSDPATAGNDAGGEGEPHSRHREARLG
STDKELKSGAAAADSVRTVPGTPRQRGPGGEVMDAAGGSRNPLPRPCHVLVLLNPRGGKG
KALQLFWSHVQPLLAQADVSFTLMLTERRNHARELVRAEDLRRWDALVVMSGDGLIHEVV
NGLMERPDWETAIQKPLCSLPAGSGNAVAASLNYYAGYEQVTKEDLLTNCTQLLCRRLLA
PMDLLSLQTACGQRLFSVLSLAWGFIADVDLESEKFRRLGEIRFTLGTCLRLVALRTYRG
TLAYLPAETLASRRGPSPAWAPQAPADTHVVPLEQPVPPHWTVVPEQDFVLVLALLHSHL
ASELFTAPMGRCSAGTMHLFYVRAGVSRATLLRLFLAMEKGRHMECHCPHLVYVPVVAFR
LEPKDGKGVFAVDGELLISEAVQGQVLPNYFWMVSGYRESPPSLKPQPSPRRKSQQRPPP
AERR
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgcgcgcgactcccagagcgtggtcccagaacctaacggggcgccccccacct
cagggggccgctccagactccaccagcgcggtttcctctccctcagatccggcaaccgca
gggaatgacgcgggcggggagggcgagccccacagccgtcaccgagaggcccgcctgggc
agcaccgataaggagctgaagtcaggagccgccgcggcggacagcgtccggacagtgccg
gggacccctcggcagcgggggccagggggcgaggtcatggatgcagcgggaggctcccgg
aatccgctcccaaggccctgccacgtgctggtgctgttaaatccgcgcgggggcaagggc
aaagccctgcagctcttctggagccacgtgcagccgctgctggcccaggccgacgtctcc
ttcacgctgatgctcactgagcggcggaaccacgcccgggagctggtgcgcgccgaggac
ctgagacgctgggacgcgctggtggtcatgtccggggacgggctgatccatgaggtggtg
aacgggctcatggagcggcctgactgggagaccgccatccagaagcccctgtgtagcctc
ccggccggctctggcaatgcggtggccgcttctttgaactattacgccgggtatgagcag
gtgactaaggaagacctcctgaccaactgcacgcagctgctgtgccgccggctgctggca
cccatggacctgctatccctgcagaccgcctgcgggcagcgcctcttctccgtgctcagc
ctggcatggggtttcatcgccgatgtggatctggagagcgagaagtttcggcgcctgggc
gagatccgcttcactctaggcacctgcctgcgcctggtggccctgcgcacctaccggggc
accctggcctacctgcccgcagaaacgctggcctccaggaggggcccctccccggcttgg
gccccgcaggcccccgcggacacccacgtggtgcccctggagcagccagtgcctcctcac
tggacggtggtgccggagcaggacttcgtgctggtgttggcactcctgcactcccacctg
gccagtgagcttttcaccgcccccatgggccgctgttcagccggcaccatgcatctgttc
tacgtgcgcgccggcgtgtcccgggccacgctgctgcgcctcttcctggccatggagaaa
ggcaggcacatggagtgccactgcccccacctggtgtatgtgcccgtggttgccttccgc
ctggagcccaaggatgggaagggtgtgtttgctgtggatggggaactgctgatcagtgag
gctgtccagggccaggttctccccaactacttctggatggtcagtggctacagggagtcc
ccaccctctctgaaaccgcagccctcaccccgcaggaagtctcagcagaggccgccccca
gcagagcgccggtga

DBGET integrated database retrieval system