KEGG   Ovis aries (sheep): 101105713Help
Entry
101105713         CDS       T03117                                 

Gene name
PLK1
Definition
(RefSeq) serine/threonine-protein kinase PLK1
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
oas  Ovis aries (sheep)
Pathway
oas04068  FoxO signaling pathway
oas04110  Cell cycle
oas04114  Oocyte meiosis
oas04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101105713 (PLK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101105713 (PLK1)
   04114 Oocyte meiosis
    101105713 (PLK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101105713 (PLK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    101105713 (PLK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    101105713 (PLK1)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     101105713 (PLK1)
Protein kinases [BR:oas01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   101105713 (PLK1)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101105713 (PLK1)
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101105713 (PLK1)
  Sister chromatid separation proteins
   Polo kinases
    101105713 (PLK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase POLO_box Pkinase_Tyr Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 101105713
NCBI-ProteinID: XP_004020890
Ensembl: ENSOARG00000017343
Position
24
AA seq 602 aa AA seqDB search
MSAAATAGKLGRAPADPGKAPGVAAPGAPTAAPPAKEIPEVLVDPRSRRRYLRGRFLGKG
GFAKCFEISDADTKEVFAGKIVPKSLLLKPHQKEKMSMEISIHRSLAHQHVVGFHGFFED
NDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHGNRVIHRDLKLGNL
FLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMY
TLLVGKPPFETSCLKETYLRIKNNEYSIPKHINPVASSLIKKMLQPDPSARPTIHELLND
EFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTILNKGMENPVPERPREKEEPV
VREASEPVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYG
LGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGSESYLTVSSHPNSLIKKITLLKYF
RNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGCVQINFFQDHTKLI
LCPLMAAVTYIDEKRDFRTYRLSLLEEYGCSKELASRLRYARAMVDKLLSSRSAANRLKA
SS
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcggcggcaactgcagggaagctggggcgggcaccagccgacccagggaaagcg
cccggagttgcagctcccggggctccgacggccgccccgccggcgaaagagattccggag
gtcctagtggaccctcgcagccggcggcgctatctacggggtcgctttttggggaagggt
ggctttgccaagtgctttgagatctcggatgcggacactaaggaggtgttcgcgggcaag
atcgtgcctaagtcgctgttgctcaaaccgcaccaaaaggagaagatgtccatggagata
tccattcaccgcagcctcgctcaccagcacgtcgtaggcttccacggctttttcgaagac
aacgacttcgtgttcgtggtgttggagctctgccgccggaggtctctcctggagctgcac
aagcggaggaaagctctcacggagcccgaggcccgctactacctgcggcagatcgtcctg
ggctgccagtacctgcacggaaaccgcgttattcacagagacctcaagctgggcaatctc
ttcctgaacgaggatctggaggtgaaaataggggattttggactggcaaccaaagtggag
tatgacggggaacggaagaagaccctgtgcgggactcctaattacatagctcctgaggtg
ctgagcaagaaagggcacagtttcgaggtggacgtatggtccattgggtgcatcatgtat
accttgttagtgggcaagccaccttttgagacctcttgcctaaaagagacctacctccgg
atcaagaacaatgaatacagtattcccaagcacatcaaccccgtggcctcctctctcatc
aagaagatgcttcagccagatcccagtgcccgtccaaccattcacgagctgctcaatgac
gagtttttcacttccggctatatccctgcccgcctccccatcacctgcctcaccattcca
ccgaggttttcaattgctcccagtagcctggaccccagcaaccggaagcctctcaccatc
ctcaataaaggcatggagaaccccgtgcctgaacgtccccgggagaaagaggaaccagtg
gtgcgggaggccagtgagcccgtcgactgccacctcagcgacatgttgcagcagctgcac
agcgtaaacgcctccaagccctcggagcgggggcttgtgaggcaagaggaggccgaggac
cctgcgtgcatccccatcttctgggtcagcaagtgggtggactattcggacaagtatggc
ctcgggtaccagctgtgtgacaacagcgtcggggtgctcttcaacgactccacacgcctc
atcctctataatgacggtgacagcctacagtatatcgagcgtgacggctcagagtcctac
ctcaccgtgagctcccaccccaactccttgataaagaagatcaccctcctgaagtatttc
cgaaactacatgagcgagcacttgctgaaggcgggcgccaacatcacgcctcgggaaggc
gacgagctggcccggctcccctacctgcggacctggttccgtacccgcagtgccatcatc
ctgcacctcagtaatggctgtgtgcagatcaacttcttccaggaccacaccaaactcatc
ctgtgcccactgatggccgccgtaacctacatcgacgagaagcgggacttccgtacatac
cgcctgagcctcctggaggagtacggctgttccaaggagctggccagccggctgcgctac
gcccgtgccatggtggacaagctgctgagctcgcgctcggccgccaaccgcctcaaggcc
tcctcatag

DBGET integrated database retrieval system