KEGG   Ovis aries (sheep): 101106419Help
Entry
101106419         CDS       T03117                                 

Definition
(RefSeq) NADH-cytochrome b5 reductase 3 isoform X1
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
oas  Ovis aries (sheep)
Pathway
oas00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:oas00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    101106419
Enzymes [BR:oas01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     101106419
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 101106419
NCBI-ProteinID: XP_012031122
Ensembl: ENSOARG00000019024
Position
3
AA seq 278 aa AA seqDB search
MKLFQRSTPAITLENPDIKYPLRLIDKEVISHDTRRFRFALPSPEHILGLPVGQHIYLSA
RIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFR
GPNGLLVYQGKGKFAIRPDKKSNPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTV
CHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDKAPEAWDYSQGFVNEEMIRDHLP
PPEEEPLVLMCGPPPMIQYACLPNLDRVGHPKERCFAF
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgttccagcgctccaccccggccatcacactcgagaatccagacatcaagtac
ccgctgcggctgattgacaaggaggtcatcagccatgacacccggcggttccgctttgcg
ctgccatcgcctgagcacatcctgggcctccccgtcggccagcacatctacctctcggct
cgaatcgatgggaacctggttattcggccctacacgcccgtctccagcgatgacgacaag
ggctttgtggacctggtcatcaaggtttacttcaaagacacccatcccaagtttcccgct
ggagggaagatgtcccagtacctggagagcatgaagattggcgacaccattgagttccgg
ggccccaacgggctgctggtctaccagggcaaaggaaagtttgccatccgtccagacaag
aagtccaaccctgtcatcaagacggtgaaatctgtgggtatgatcgcaggaggaacgggc
atcacgccaatgctacaggtgatccgcgccatcatgaaggaccctgatgaccacaccgtg
tgccacctgctctttgccaaccagaccgagaaggacatcctgctgcggcccgagctggag
gaactgaggaacgagcactctgcacgcttcaagctctggtacacggtggacaaagcccct
gaagcctgggactacagccagggcttcgtgaacgaggagatgatccgggaccacctgccg
cccccagaggaggaaccgctggtgctgatgtgcggacccccacccatgatccagtatgcc
tgcctgcccaacctggaccgcgtgggccacccgaaggagcgctgctttgccttctga

DBGET integrated database retrieval system