KEGG   Ovis aries (sheep): 101107261Help
Entry
101107261         CDS       T03117                                 

Definition
(RefSeq) mast cell protease 2 precursor
  KO
K01329  chymase [EC:3.4.21.39]
Organism
oas  Ovis aries (sheep)
Pathway
oas04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:oas00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    101107261
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:oas01002]
    101107261
Enzymes [BR:oas01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.39  chymase
     101107261
Peptidases [BR:oas01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101107261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin
Motif
Other DBs
NCBI-GeneID: 101107261
NCBI-ProteinID: NP_001009757
UniProt: Q8HXR1
AA seq 229 aa AA seqDB search
MEMVXTGEIIGGTESKPHSCPYMAYLEIVTSREKQVACGGFLIRRDFVLMAAHCAGRSVT
VTLGAHNIQKKEDTWQRLEVIKQFPYPKYEPVGLHDIMLLKLKEKANLTLAVGTLPLPSP
VTFMCPGRMCQVAGWGRTGVKEPASSTLQEVKLRLMEPRACRHFPAFDHNLQLCVGNPQT
QNLRLRETQGALFCVLRWPRALSPMDCPVQSPRPSSPGSPLTGPGSMRS
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggagatggtggwgacaggggagatcatcgggggcacagagagcaagccacactcctgt
ccctacatggcctacctggaaattgtcacctcacgggagaagcaggtggcttgtggtggt
ttcctgataagaagggactttgtgctgatggctgcgcactgtgcaggaaggtctgtaaca
gtcaccctcggtgcccataacatacaaaagaaagaagacacatggcagaggcttgaggtc
ataaaacagtttccttacccaaaatatgagcctgttggtctccacgacatcatgttactg
aagttgaaggagaaagccaacctgaccctggccgtggggacactcccccttccatcccct
gtcaccttcatgtgtcccgggagaatgtgccaggtggctggctggggaagaacaggtgtg
aaggaaccagcctccagcactctgcaagaggtgaagctgagactcatggagccccgggcc
tgccgccacttccctgcttttgaccacaatctccagctgtgtgtgggcaatccccagaca
caaaatctgcgtttaagggagactcagggggccctcttttgtgtgctgcggtggcccagg
gcattgtctcctatggactgtccagtgcaaagcccccggccgtcttcacctggatctccc
cttaccggccctggatcgatgaggtcctga

DBGET integrated database retrieval system