KEGG   Ovis aries (sheep): 101108766Help
Entry
101108766         CDS       T03117                                 

Gene name
PIK3C2B
Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
oas  Ovis aries (sheep)
Pathway
oas00562  Inositol phosphate metabolism
oas01100  Metabolic pathways
oas04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101108766 (PIK3C2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    101108766 (PIK3C2B)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     101108766 (PIK3C2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3K_C2 PI3K_rbd HEAT_2
Motif
Other DBs
NCBI-GeneID: 101108766
NCBI-ProteinID: XP_027831994
Ensembl: ENSOARG00000002639
Position
12
AA seq 1073 aa AA seqDB search
MSSTQGSGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEESRAKQNADPSLISW
DEPVLDVYSKPAGRRKDLKLLRGLSGSDPTLNYNSVSPQEGLSNHSTSRGSQPGPDPWPK
GSLAEDYLYIFDGSDGGLSLSPGPRHREDSSKKLSPPPLPPRVSIWDTPPLPPRKGSPSS
SKVSQPSDINTFSLVEQPPGKLLGPRILEEEEELGGGSPGRPLGSMDYDGINDAITRLNL
KSTYDAEMLRDATRDWKEGRGPLDFAKDTPGKPVARSKTMPPQVPPRTYASRCANRKNAT
PGKNRRISAAPVGSRPHAVANGHELFEVSEERDEEVAAFCHMLDVLRSGSDVRDYSLTGY
VWSAVTPSPEHLGDEVNLKVTVLCDSLREPLTFTCNCSSTVDLLIYQTLCYTRDELRDVD
VGDFVLKPCGLEEFLQNKHALGSHEYIQYCRKFGVDIRLQLMEQKTVRGDLARTVNDDQS
PSTLNYLVHLQERPVKQTISRQALSLLFDTYHNEVDAFLLADGDFPLKADRVVQSVKAIC
NALAAVETPEITSALNQLPPCPSRMKPKIQKDPTVLAVRENREKVVEALTAAILDLVELY
CNTFNADFQTAAPGSRKHALVQEACHLSGPLAFTVYATHRIPIVWATSYEEFYLSCSLSH
GGKELCSPLQTRRVHFSKYLFHLVIWDQQICFPVQLNRLPRETLLCATLYALPVPPPGSS
SEANKQRRVPEALGWVTAPLFNFRQVLTCGRKLLGLWPATQESPSARWSAPNFHQPDSVI
LQIDFPTSAFDIKFTSPAGDKFSPRYEFGSLREEDQHVLKSIVQKESLYWLTDADKKRLW
EKRYYCHAEVSALPLVLASAPSWEWACLPDTYALLAQWTPMNHQDALGLLHATFPDQEVR
RMAVQWIGSLSDAELLDYLPQLVQALKYECYLDSPLVRFLLKRAVSDLRVTHYFFWLLKD
GLKDSQFSIRYQYLLAALLCCCGKGLREEFNRQCWLVNTLAKLAQQVREAAPSARQGILR
AGLEEVEQFFALNGSCRLPLSPSLLVKGVVPRVSDWRVRGSRSGEGSWKQGPH
NT seq 3222 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgactcagggcagtggggagcactggaagtccctggagtcggtgggcatcagc
cgcaaagagctggccatggctgaagccttgcagatggagtacgatgcgctgtcccggctt
cggcacgacaaggaggaaagcagggcaaagcagaacgcagacccctctctgatcagctgg
gatgagcctgtcctggatgtctatagcaagccagccggaaggcggaaggacctcaagctg
ctacgcggtctttctggctccgatcctaccctcaattacaactcagtctccccacaggaa
gggctgtccaaccactctacctcccggggctcccagcctggcccagatccctggcccaaa
ggctccctggccgaagactatctctacatttttgatggttcagatggggggctctccctg
tccccaggaccaaggcacagagaagactcttctaagaaactgtccccgcctcctctgcct
ccccgagtctctatctgggacactcctcccctgcctcccaggaaggggtccccctcctct
tccaaggtttcccagcccagtgacatcaacactttctctttggttgaacaacctccaggc
aagttgctggggccccggatcctagaggaggaggaggagctgggaggtgggagtccgggg
cggccgctggggtccatggactacgacggcatcaatgacgccatcacacggctcaacctg
aagtcgacctacgacgcagagatgctgcgggatgccaccagggactggaaggagggtcgg
gggcccctggactttgccaaggacactcctgggaagcccgtggcccggagcaagaccatg
cccccccaggtgcccccccgcacatacgcctctcgctgcgccaaccggaaaaacgcaaca
cccggcaagaaccgccgcatttccgcagccccggtgggctcccggccccacgccgtcgcc
aatggccatgagctgtttgaggtctcagaggagagagatgaggaggttgctgcattttgc
cacatgctggatgtcctccgatccggctctgatgtccgggactactccctcaccgggtat
gtctggagtgctgtcaccccgagcccggagcaccttggggacgaggtgaacctgaaggtg
accgtgctgtgtgacagcctgcgggaaccactcacttttacctgcaactgctcctccact
gtagacttgctcatctaccagaccctgtgctacacccgtgatgaactgagggatgtcgac
gtgggtgactttgtgctgaagccctgtgggctggaggagttcctgcagaacaagcacgcc
ctgggcagccacgagtatatccagtactgtcggaagtttggcgtcgacatccggctgcag
ctgatggagcagaagaccgtgcgcggtgacctggcccgcacggtgaacgatgaccagagc
ccctccaccttgaactacctcgtccacctgcaggagaggccagtcaagcagaccatcagc
aggcaggccctgagtcttctgttcgacacttaccacaatgaggtggatgccttcctgttg
gctgatggggacttcccactgaaggccgacagggtggtccagtccgtcaaggccatctgc
aatgccctagctgccgtggaaacccctgagatcaccagcgctctcaaccagctgcccccc
tgcccttcccgaatgaagcctaaaatccagaaggatcccaccgtcttggccgtgagggaa
aaccgagagaaggtcgtggaagccttgacggctgccatcttggacctggtggagctgtac
tgcaacacgttcaacgcagacttccagactgcggcgcctgggagccgcaagcacgccctg
gttcaggaggcctgccatctctccgggccgctggccttcacggtctacgccacccaccgc
atcccgatcgtctgggctaccagctatgaagagttctacctctcctgctccctcagccac
ggcggcaaggaactgtgcagccccctgcagacccgacgggtccacttctccaagtacctc
ttccacctcgtcatctgggaccaacagatctgcttccctgtgcagctgaaccggctgcct
cgggagaccctgctgtgcgccaccctctacgctctgcccgtgcccccgcctgggagctcc
tcggaggccaacaagcagcggcgggtgcctgaagctctgggctgggtcactgctccactc
ttcaacttcaggcaagtcctgacctgtggccggaagcttctgggcttatggccggcaaca
caggaaagtcccagtgcccgctggagtgcacctaatttccatcagccagatagtgtgatc
ctgcagattgactttcccacctcggcctttgacatcaagttcaccagccctgctggagac
aagttcagcccccgctatgagtttggcagcctccgggaggaagaccaacatgtacttaag
agcatcgtgcagaaagagtccctgtactggctcacggatgcggacaaaaagcgcctgtgg
gagaagcgatattactgccacgcggaggtgagcgcgctgccgctggtgcttgccagcgcg
cccagctgggagtgggcctgcctccccgacacctatgctctgctggcgcagtggaccccc
atgaaccaccaggacgccctggggctcctgcacgccacgttcccagaccaggaggtgcgt
cgcatggccgtacagtggatcggctccctctctgatgccgagctgctggactacttgccc
cagctcgtgcaggccttaaagtatgaatgctacctggacagtcccttggtgcgcttcctc
ctgaagcgagcggtctctgacttgagagtgactcactacttcttctggttgctgaaggac
ggcctcaaagactctcagttcagcatccgttaccagtacctgctggctgccttgttgtgt
tgctgtggcaaggggctgagagaggagtttaaccgccagtgctggcttgttaataccctg
gccaaactggcccagcaggtccgggaggctgccccgtctgcacggcagggcatcctccgt
gccggcctggaggaggtggagcagttcttcgccctcaacggctcctgccgcctgcccctc
agccccagcctgctggttaagggcgttgtgcccagggtgagcgactggcgggtgcggggc
tctcggagtggggagggctcatggaagcagggccctcactga

DBGET integrated database retrieval system