KEGG   Ovis aries (sheep): 101109277
Entry
101109277         CDS       T03117                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
oas  Ovis aries (sheep)
Brite
KEGG Orthology (KO) [BR:oas00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oas01009]
    101109277 (AKAP5)
Protein phosphatases and associated proteins [BR:oas01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     101109277 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 101109277
NCBI-ProteinID: XP_012037206
Ensembl: ENSOARG00000000991
UniProt: W5NS86
Position
7
AA seq 428 aa
MEITVSEIQVESKDETRSAEVRRQDERQEEKASMLCFKRRKKAAKAMKPEASSKAADATR
KCPPEAGASDQPQRPGGAWASIKRLVTRRKRSESSKQQKPFEAKLQSEINAEDANPSKKK
AKSRLKIPCIKFSKGEKRSNHSKIIEDSDRSVKVQEAENLVTKTLTQSDDQTTKSKSPQD
VREAVSQKGDDEVCESNVNNSITSPGEKVISVELELDMGHSAIQTGTLILEKDTEMLEEK
QSTQPQQLSPLEASDTEQELPVGSEIPPSPAVPDQQILDEARNGVLESGPDWKEHGSREI
VVEESKPKDTELSQELDFQENEITAEKPKPEESKRMEPIAIIITDTEISEFDVKKSKNVP
KPFLISIENEQVGVFANDSGFEGRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDD
NTINNRLQ
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggagatcacagtttctgaaatacaagtagaaagcaaggatgagacgagatcagcagaa
gttagacgtcaggatgagaggcaggaagaaaaagcatcgatgctctgcttcaagagaaga
aaaaaagcagccaaagcaatgaagcccgaagccagctctaaagctgctgatgcaacaagg
aagtgtcctccagaagcaggagcttctgatcagccacagcgccctggcggggcctgggcc
tcaatcaaacgccttgtaacacgaaggaaaaggtcagagtcttcaaagcagcaaaagccc
tttgaggctaaactgcaatcggaaatcaatgctgaggatgctaatccttctaagaaaaag
gcaaaatccagactcaagattccctgcataaaattctcaaaaggagagaaaagaagtaat
cactccaaaatcatagaagattcagaccgcagtgtcaaagtccaagaggctgaaaatctg
gttacaaaaactcttacccaatcagatgaccagacaacaaagagcaagtcgccccaggat
gtaagggaagctgtctcacagaaaggggatgatgaggtctgtgaatcaaatgtgaacaac
agcataacttctcctggagagaaagtgatttcagtagaacttgagttagatatgggtcat
tctgctattcaaacaggaactctaatccttgaaaaagatactgaaatgcttgaggaaaaa
caaagcactcaacctcagcaactgagcccattggaagcttcagacacagaacaggagctc
ccagtgggttctgagattcctccctcgcctgcagtcccagatcaacaaattctggatgaa
gccagaaatggtgtcctagaaagtggaccagattggaaggagcatggaagtagagagatt
gttgttgaggagagtaagccaaaagatactgaattgagccaggaattggattttcaagaa
aatgagatcactgcagaaaaacccaaaccagaagaaagcaaaagaatggagccaattgct
attattatcacagacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtccct
aagccattcttaatttcaattgaaaatgagcaagtaggggtttttgctaatgacagtggt
tttgagggtagaacttcggaacaatatgaaacactcttaatagaaacagcttcttctctt
gtcaagaatgctatccagttgtctatagaacagcttgttaatgaaatggcctctgatgat
aatacaataaataatcgtctacagtga

DBGET integrated database retrieval system