KEGG   Ovis aries (sheep): 101109301
Entry
101109301         CDS       T03117                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
oas  Ovis aries (sheep)
Brite
KEGG Orthology (KO) [BR:oas00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    101109301 (AHRR)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101109301 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 101109301
NCBI-ProteinID: XP_027835766
Position
16
AA seq 698 aa
MIPPGECLYAGRKRRKPVQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPLPPDIISK
LDKLSVLRLSVSYLRVKSFFQALQERCPRQLVAAAPSPGDRGPRRGSAGSAVLEGRLLLE
SLHGFALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFRRQLHWAMDP
PQAGCGQPLLSETGEDAVLGRLLRAQEGGADPPTEYSAFLTRSFVCRVRCLLDSTSGFLT
MQFQGRLKFLFGQNRRAPSGAALPPRLALFCVAAPLALPPGVEVRMKTVYLRAKHRADVP
ASTDAKAKAASRLCESELLGNPNYSAGRSNRENGLSLFRAPEDACRWGRLTARGPCLCLR
GGPDLVLDLEGTAGAGEGEELGGLPRDVPPYSCRLEPLGPVKHLDWAAGRHSQDSGSAKR
KLEPGKADPFPAAPARGACLPYPGAQGAVHSLRSAPSSHPSRPPPGACASRPSRALRDGH
QGPAPPPTPGPFPQGGLDSRVPRPAVQHLPVGGYPAEDKLRGLLMPPGAPSHPTLSLDVP
IKMESDSGSEDAVDGYCVSPAQVWLGASNPAKRQLATFPTKMHLKTEPGARQPLYSPPPG
PGLLGAPPRPGRGLGPLHPVSCACLEPPPPPRLCVRSHQPPNLGCNCRAPVPAPAVKLEP
LDSPLWAAHGQGGPPGLFSKSAPAAGMPPRDVQCAFLP
NT seq 2097 nt   +upstreamnt  +downstreamnt
atgatcccaccgggggaatgcctatatgccgggaggaaacgcaggaagcccgttcagaaa
cagaggcccgccgtgggcgctgagaagtcgaacccctccaagcggcaccgggaccgcctg
aacgctgagctggaccacctggccagcctgctgccgctgccgcccgacatcatctctaag
ctcgacaagctttccgtcctgcgcctcagtgtcagctacctcagggtgaagagcttcttc
caagccctgcaggagaggtgcccaaggcagctggtggctgctgccccgtcgccaggagac
cggggtccacgcagagggtctgcaggctcagccgtgctggagggaaggctgctgctggag
tccctccacggcttcgctctggtggtgagcgcggaagggatgatcttctacgcgtcggcc
acgatcgtggactacctgggcttccaccagacggacgtgatgcaccagaatatttacgac
tacatccacgtggatgaccgccaggacttccgccggcagctgcactgggccatggaccct
cctcaggcagggtgcgggcagcccctgctctcggagacaggagaggatgcggtcctgggg
aggctgctccgggcccaggaagggggcgcagacccgcccaccgagtactcggccttcctg
acccgctccttcgtctgccgtgtgcgctgcctgctggacagcacctcgggcttcctgacg
atgcagtttcaaggacgactgaagttcctcttcggacagaacaggcgggcaccctcgggc
gcggccctgcccccacggctggccctgttctgcgtggcggcccctctggccctgcccccc
ggcgtggaggtgaggatgaagaccgtgtacctgagggcgaagcacagggcggacgtcccg
gcctcaaccgacgcgaaagcaaaagctgcctcacgtctctgcgaatcagaattgctcgga
aaccccaattactcagcagggagaagcaacagagaaaacggcctctccttgttcagggcg
ccagaggacgcctgccgctggggccggctcacagcccggggcccctgcctgtgcctccgg
ggaggccctgacctcgtccttgacctcgagggcaccgcaggggccggggaaggagaggag
ctcggggggctcccgcgggatgtgcccccgtacagctgccgcctagagcccctgggccct
gtgaagcacctggactgggctgctgggaggcacagtcaggacagcggcagcgccaagcgg
aagctggagcccggcaaggccgacccgttccccgccgccccggcccgtggcgcctgcctg
ccctacccgggtgcgcagggcgccgtccactccctccggagcgcacccagctcacacccg
tccaggccgccccctggggcctgcgccagccggcccagcagagccctgcgggacgggcac
cagggcccagcaccgccccccacccccggccccttcccccaggggggcctggacagcagg
gtccctcggccggcagtccagcatctcccagtgggcggctaccccgctgaggacaagctg
cgaggccttctgatgcccccaggagccccgagtcaccccacattgtcgctcgacgtgccc
atcaagatggagagtgactcggggtccgaggatgcagtggatggctactgcgtgtcccca
gcccaggtgtggctgggggccagcaacccagccaagagacagctggccaccttcccaacc
aagatgcacctgaagacagagccaggcgccaggcagcccctgtacagcccacccccaggc
cctggcctgctgggtgccccgcccagacccggcagggggctgggcccgctgcaccccgtg
tcctgtgcctgcctggagcccccgcccccgccccgcctctgtgtgcggagccaccagccc
cccaacctgggctgcaactgccgggctcccgtgccagctcccgcagtcaagctcgagccc
ctggactcgcccctgtgggcagctcacggccaaggtgggccgcctgggctgttctccaag
agcgccccggccgcagggatgccccccagggacgtgcagtgcgccttcctgccctag

DBGET integrated database retrieval system