KEGG   Ovis aries (sheep): 101109820Help
Entry
101109820         CDS       T03117                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: NADH-cytochrome b5 reductase 1
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
oas  Ovis aries (sheep)
Pathway
oas00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:oas00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    101109820
Enzymes [BR:oas01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     101109820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 101109820
NCBI-ProteinID: XP_014954895
Ensembl: ENSOARG00000018076
Position
12
AA seq 305 aa AA seqDB search
MGLQPSPVLLASLGVGLLTLSAXALGAYLVRRSRRPPVTLLDPNEKYRLRLLDKTTVNHN
TKRFRFALPTAHHVLGLPVGKHVYLSARIDGSLVIRPYTPITSDEDQGYVDLVIKVYLKG
VHPKFPEGGKMSQYLDSLKIGDMVEFRGPSGLLTYAGKGKFNIQTNKKAPPEARVARNLG
MIAGGTGITPMLQLIRAILKDPEDPTQCSLLFANQTEKDIILREDLEELQAQHPNRFKLW
FTLDHPPEGWAYSKGFVSADMIRERLPAPGEDTLLLLCGPPPMVQQACHPSLDKLGYSPK
MRFTY
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggggctgcagccgagcccggtcctgctggcctccctgggcgtggggctgctgacgctg
tcggcgnntgctctgggcgcctacctggtgcggaggtcccgccggccgccagtcacgctc
ctggaccccaatgagaagtaccggctgcgactgctagacaagactaccgtgaatcacaac
accaagaggttccgctttgccctgcccacggctcaccacgttctggggctgcctgtgggc
aaacatgtctacctctctgcccggatcgacggcagcctggtcatcaggccgtacactccc
atcaccagcgatgaggaccagggctacgtggatcttgtcatcaaggtctatctgaagggc
gtgcaccccaaatttcctgagggagggaagatgtctcagtacctggatagcctgaagatt
ggggacatggtggagtttcgggggccaagtgggctgctcacttacgcgggaaaagggaag
tttaacatccagaccaacaaaaaggctccaccagaagcccgcgtggccaggaacctggga
atgattgccggaggcacaggaatcactccaatgctgcagctgatccgggccatcctgaaa
gaccccgaagatcctacccagtgctctctgctgtttgccaatcagactgaaaaggacata
atcttacgagaggacttggaggagctgcaggcccaacaccccaaccgctttaagctctgg
ttcaccctggatcaccccccagaaggttgggcctacagcaagggctttgtctctgcggac
atgatccgggagcgcctgcccgcccccggggaggacacgctgctgctgctctgtggacca
cccccgatggtgcagcaggcctgccaccctagcctggacaaactgggctactcgccgaag
atgcgcttcacctactga

DBGET integrated database retrieval system