KEGG   Ovis aries (sheep): 101110289Help
Entry
101110289         CDS       T03117                                 

Gene name
TIPARP
Definition
(RefSeq) protein mono-ADP-ribosyltransferase TIPARP
  KO
K15259  poly [ADP-ribose] polymerase 7/11/12/13 [EC:2.4.2.30]
Organism
oas  Ovis aries (sheep)
Brite
KEGG Orthology (KO) [BR:oas00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101110289 (TIPARP)
Enzymes [BR:oas01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     101110289 (TIPARP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP WWE Torus zf-CCCH
Motif
Other DBs
NCBI-GeneID: 101110289
NCBI-ProteinID: XP_004003271
Ensembl: ENSOARG00000002923
UniProt: W5NY57
Position
1
AA seq 656 aa AA seqDB search
MEVETTEPEPDCVVQPPSPDEFSCPVRLSEKITPLKTCFKKKDQKRLGTGTLRSLRPILN
TLLESGSLDGVFRSRNQSAEESSLHEPMVKKPLEINTSCPPTENSMSVLIPDGTNVGAQM
PEAHPPTDAPEQVVPIQDHSFPPETISGTVADSTAGHFQTDLLHPVSSDVPASPDCIDKV
MDYVPGVFQDNSFTIQYILDTSDKLSTELFQDKSEEASLDLVFELVNQLQYHTHQENGIE
ICMDFLQGTCIYGRDCLKHHTILPYHWQIKRTTTQKWQSVSNDSQEHLERFYCNPENDRM
RMKYGGQEFWADLNAMNVYETAEFDQLRRLSTPPSSNANSIYHTVWKFFCRDHFGWREYP
ESVIRLIEEANSRGLKEVRFMMWNNHYILHNSFFRREIKRRPLFRSCFILLPYLQTLGGV
PTQAPPPLEATSSSQIICPDGVTSANFYPETWVYMHPSQDFIQVPVSAEDKSYRIIYNLF
HKTVPEFKYRILQILRVQNQFLWEKYKRKKEYMNRKMFGRDRIINERHLFHGTSQDVVDG
ICKHNFDPRVCGKHATMFGQGSYFAKKASYSHNFSKKSSKGVHFMFLAKVLTGRYTMGSH
GMRRPPPVNPGSVTSDLYDSCVDNFFEPQIFVIFNDDQSYPYFVIQYEEVSNTVSI
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggaagtggaaaccactgaacctgagccagactgtgtagtgcagcctccttctcctgat
gaattttcatgcccagtgagactctctgagaagatcactccgttgaagacttgttttaag
aaaaaagatcagaagaggttgggaaccggaaccttgaggtctttgaggccaatattaaac
actttgttagaatctggctcacttgatggggtttttagatctagaaaccagagtgcagaa
gagagcagcttacatgaacctatggtgaagaaacccttggaaatcaatacatcgtgtcca
cctactgaaaacagtatgtctgtcctgattcctgatgggacaaatgttggggcccagatg
ccagaagcccatcctcccactgatgctccggagcaggtggttccaatccaggatcatagc
tttccaccagaaaccatcagtgggacagtggcagattctacagcagggcacttccagact
gaccttttgcacccagtttcaagtgatgttcctgctagtcccgactgcatagacaaagtc
atggattatgttccaggggttttccaagataacagttttacaatccagtacattttggac
accagtgacaagttgagtaccgagctctttcaggacaaaagtgaggaggcctcccttgac
cttgtgtttgagctggtgaaccagctacagtaccacactcaccaagagaatggaattgaa
atttgcatggactttttgcaaggcacttgtatttatggcagggattgtttgaagcaccac
acgatcttgccatatcactggcagatcaagaggacaactacgcaaaagtggcagagtgta
tccaatgactcccaggaacacttggaaagattttactgtaacccagaaaatgatagaatg
agaatgaagtatggaggacaagaattttgggcagatttgaatgccatgaatgtgtatgaa
acagctgaatttgaccaactacgaaggctgtccacaccaccctctagcaatgccaactct
atttaccacacagtctggaaattcttctgtagggaccactttggatggagggagtatcct
gagtctgttattcgattgattgaagaagccaactctcgaggtttgaaagaagtccgattt
atgatgtggaacaaccactacattctccacaactcattcttcagaagagaaataaaaagg
agaccccttttccgttcatgttttatactgcttccatatttacagacacttggtggtgtt
cccacacaggctcctccacctcttgaagcaacctcctcatcgcagatcatctgcccagat
ggggtcacctcagcaaacttttaccctgaaacttgggtttatatgcatccttctcaggac
ttcatccaagtgcctgtttctgcagaggacaaaagttaccgaattatctataatcttttt
cataagactgtgcctgagtttaaatatagaattttgcaaatattgagagtccaaaatcag
tttctttgggaaaaatataaaaggaaaaaggaatatatgaaccggaaaatgtttggccgt
gacagaataataaatgagagacatttatttcatggaacatcccaggatgtggtagatggg
atctgcaagcacaactttgatccgcgagtctgtggaaagcatgctacaatgtttggacag
ggcagttactttgcaaagaaggcaagctactctcataacttttctaagaagtcctccaaa
ggagtccatttcatgtttctggctaaagtgctaactggcagatacacgatgggcagtcac
ggcatgagaaggccccctcccgtcaaccccggcagcgtcaccagtgacctgtatgactct
tgtgtcgataatttctttgagcctcagatttttgtcatttttaatgatgaccagagttac
ccttattttgttatccaatatgaagaagtcagtaacactgtttccatctga

DBGET integrated database retrieval system