KEGG   Ovis aries (sheep): 101110506
Entry
101110506         CDS       T03117                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1 isoform X2
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
oas  Ovis aries (sheep)
Brite
KEGG Orthology (KO) [BR:oas00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oas01002]
    101110506 (ERAP1)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     101110506 (ERAP1)
Peptidases and inhibitors [BR:oas01002]
 Metallo peptidases
  Family M1
   101110506 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 101110506
NCBI-ProteinID: XP_004009139
Ensembl: ENSOARG00000017807
UniProt: W5Q8S5
Position
5
AA seq 942 aa
MISPSVKWPLATRPLLLSTLLILLTVATPSSCQSREPTFPKASNGAPFPWNKMRLPEHII
PAHYDLMIHANLTTLTFGGTTQIEITASEPTSTIILHSHHLQVSKATLRKGGGERQAEEP
LRVLENPPQEQIALLASKPLVVGLPYTIVIDYTGNLSESFHGFYKSTYRTKEGEVRVLAS
TQFEPTAARMAFPCFDEPAFKASFLIKIRREPRHLAISNMPLVKSVIVAEGLIEDHFDVT
VKMSTYLVAFIVSDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFNI
PYPLPKQDLAAIPDFQSGAMENWGLTTYRESSLLFDAEKSSASSKLGITMIVSHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVEEYFFGKCFNAMEVDALNSSHPV
STPVENPAQIREMFDEVSYDKGACILNMLRDYLGADAFKSGIVKYLQKYSYKNTKNEDLW
NSMASICPTDDTQHMDGFCSRGEHSSSTAHWRREGLDVKTMMNTWTLQKGFPLITITVRG
RNAHVKQEYYVKGVADAPETGLLWHIPLTFITSKSDAVQRFLLKTRTDVLILPEEVEWIK
FNVGMNGYYIVHYEDDGWDSLTGLLKGTHTAISSNDRASLINNAFQLVSIGKLSIEKALD
LTLYLKHETEIMPVFQGLNELIPMYKLMEKREMNEVETQFKAFLIRLLRGLIDKQTWTDE
GSVSERMLRSQLLLLACVRKYQPCVQKAEGYFRQWQEAGGNFSLPNDVTLAVFAVGAQTL
EGWDFLYSKYQSSLSSTEKNQIEFALCISQNKEKLQWLLDQSFKGDVIKTQEFPGILRAI
GRNPVGYLLAWQFLRENWNKLVQKFELGSSSIAYMVTGTTNQFSTRARLEEVKEFFSSLK
ENGSQLRCVQQTIETIEENIRWMDKNFDKIKAWLQNEQLNLL
NT seq 2829 nt   +upstreamnt  +downstreamnt
atgatatctccatccgtcaaatggccacttgcaaccaggcccttgctgctttcgacactg
ttgattctcttaaccgtggcaactccatcctcatgtcagagcagggaaccaacatttcca
aaagctagcaacggggcaccgtttccttggaataaaatgcggcttccagagcacatcatc
ccagctcattacgatctcatgattcatgcaaatctcaccactctgactttcgggggaacc
acacagatagaaatcacagccagcgagcccaccagtaccatcatcctgcacagtcaccac
ctacaagtatccaaggccaccctgaggaagggaggtggagagaggcaagctgaagagcca
ctgagagtcctggaaaacccacctcaggagcaaattgcgcttctggcttccaagccgctg
gtcgtcggcctcccatacaccattgtcatcgactacactggcaatctttctgagagtttc
catggattttataaaagtacctacagaaccaaagaaggagaagtgagggtacttgcatca
acacagttcgaaccgactgcagccagaatggcctttccatgctttgatgaacctgctttc
aaggcgagttttttaatcaagatcagaagggaaccaagacacctcgccatctccaatatg
ccattggttaaatctgtgattgtggctgaaggactcatagaagaccactttgacgtcacc
gtgaagatgagcacctacctggtggccttcattgtttcggattttaagtctgtcagcaag
atgaccaagagcggagtcaaggtttctgtatatgccgttccagacaagataaatcaggca
gattatgcactggatgccgcggtgactcttctagaattttatgaggattatttcaacatc
ccatatccgttacccaaacaagatcttgctgcgattcctgacttccagtctggtgcaatg
gaaaactggggactgacaacgtacagggaatcttctctactgtttgatgctgagaagtct
tccgcctcaagtaagctcggcatcacgatgattgtgtctcacgaactcgcccaccagtgg
tttgggaacctcgtcactatggaatggtggaatgatctttggctaaatgagggatttgcc
aagttcatggagttcgtgtcagtcagtgtgactcatccagaactgaaagttgaagagtat
ttctttggtaagtgtttcaatgcaatggaggtggatgcattaaactcctcacaccccgtg
tccacacccgtggagaatcctgctcagattcgggagatgtttgatgaagtttcttatgac
aagggagcttgtattctgaatatgctaagggactatcttggtgccgacgcatttaaaagt
ggcattgtaaagtatctgcagaagtatagctataaaaacacgaaaaacgaggacctgtgg
aatagcatggcaagcatttgccctacagatgacacgcaacacatggatggattttgttct
agaggtgaacattcatcttcaaccgcgcactggcgacgggaaggccttgatgtgaaaacc
atgatgaacacctggacgctgcagaagggttttcccctgataaccatcaccgtgagaggc
agaaacgcccacgtgaagcaagagtactatgtgaaaggcgtggctgatgccccagaaact
gggctcctgtggcacatcccactgacattcattaccagcaaatcagacgcagtccagcgc
tttttgctgaagacaagaacagatgtgctcatcctcccagaagaggtggaatggatcaaa
tttaatgtcggaatgaatggctattacattgtgcactatgaggatgatggatgggactct
ctgactggccttttaaaaggaacacacacggcaatcagcagtaatgatcgggccagtctc
attaacaatgcatttcagctcgtcagcattggaaagctatcaattgagaaagccttggat
ttaaccttgtacctgaagcatgaaactgaaatcatgccagtgtttcaaggtttgaatgag
ctgataccgatgtataagttaatggagaagagagagatgaatgaagtggaaactcaattc
aaggcctttctcatcaggctgctgaggggcctcattgacaagcagacgtggacagatgag
ggctccgtctcggagcgaatgctgcggagtcagctgctcctccttgcctgcgtgcgcaag
taccagccctgcgtgcagaaggcagaaggctatttcagacagtggcaggaagccggggga
aacttcagcctgcccaatgatgtgaccttggcagtgtttgccgtgggggcccagaccctc
gaaggatgggattttctttatagtaaataccagtcatcattgtccagtactgagaaaaac
caaattgaatttgctctctgtatcagccaaaataaagaaaagcttcagtggctactagac
caaagttttaagggagatgtaataaaaactcaagagtttccaggtattcttagagctatt
ggcagaaacccagtgggatatctgttggcctggcagtttctgagggaaaactggaacaaa
cttgtgcaaaagtttgaactgggctcaagttccatagcctacatggtaacgggaacaaca
aatcagttttcaacaagagcacggctcgaagaggtaaaagaattcttcagctctttgaag
gaaaacgggtctcagctccgttgtgttcaacaaaccatcgagaccatcgaggagaacata
cgctggatggataagaattttgataagatcaaagcgtggctgcaaaatgagcagcttaac
ctgctgtaa

DBGET integrated database retrieval system