KEGG   Ovis aries (sheep): 101112214
Entry
101112214         CDS       T03117                                 

Gene name
ADAMTS13
Definition
(RefSeq) LOW QUALITY PROTEIN: A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
oas  Ovis aries (sheep)
Brite
KEGG Orthology (KO) [BR:oas00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oas01002]
    101112214 (ADAMTS13)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     101112214 (ADAMTS13)
Peptidases and inhibitors [BR:oas01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   101112214 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin TSP1_CCN Reprolysin_3 Reprolysin_4 TSP1_spondin Reprolysin_5 Peptidase_M10 Reprolysin_2
Other DBs
NCBI-GeneID: 101112214
NCBI-ProteinID: XP_027821920
UniProt: A0A6P7DTC9
Position
3
AA seq 1511 aa
MIAGSMAPSTLGRCMQGTLTSALFLLSCWALPDPRQQFLQALEPGDVTSYFGPDAAFEAP
PFDVASPACACKHKDEGGLAGPPCRALCCSLAALGRLFSFCFQPELGLLAASFASELAVS
ASLWLLRGPPHPCLTGGRALLPPEAAARLTYCLGLVEGDILVGADGFYIQPLRRQHRALV
HLWEGGAQPHLIHRPTPGAPTVPEPRFTRFPGPRLSALPAPSPGRPPAPRLRRWSTGHVL
HLELLVAVGPDVQRTHGEETERYVLTNLNMGSELLRDPSLGAQFRVHLVKMVILTQPEDA
PKITANITASLLSVCEWSKTVNPEDDTDPGHADLVLYITRFDLELPDGNRQVRGVTQLGG
ACSSSWSCLITEDTGFDLGLTIAHEIGHSFGLEHDGVPGSSCGPSGHVMASDGAAPALAL
GGPAWSPCSRRQLLSLLSAGRARCMWDPPAQRPGPAGRPPEAQPGLYYGADEQCRVAFGP
TAVACTFRGEHLDMCQALSCHTDPLDPSSCSRLLIPLLDGTECGVGKWCSKGHCRSLAEL
APVGVVHGHWSGWGPASPCSRSCGGGVVTRRRRCDNPRPAFGGRACVGSDLQAEMCNTQA
CETTQLEFMSEQCAQTDGEPLHLSPGGSTSFYRWGTAEQYSKGNALCRHVCRAVGESFMV
RRGDRFLDGTRCVLGDSQEDGALSLCVSGSCRTFGCDGRMDSGQVRDVCQVCGGDSSTCR
PQNGSFTAGRAREYVTFLTVTPNLTSISVINRRPLFTHLAVKVRGRYIVAGNGSISASTS
YPSLLEDNRVEYRVTLSEDQLPRREEIRIWGPTRDDMEIQVYRRYGEEYGSPARPDITFT
YFQPEQRRAWAWAPLRGPCSVSCGAGLRQVTYSCWDQSRSEWVEAARCAGSRPPEAWSEA
CTLEPCPPQDEATDACSSACGADPAVQNTTCMPGADGTGLSATAGPCSADEKPPALEPCV
EAACPPSWDQVSLDVRSPGQEAASPTGGPRLEALAKHVWTPLAGPCSASCGQGLAELHFV
CMDPALRTPVREELCDLASKPGSRREACQAAPCPARWRYKLAACSLSCGGGVAQRILYCA
RAHGEDTDEEILPDTQCQGLPRPEQQEACSPEPCPPRWKVTSLGPCSASCGLGTATRSVA
CVRLDRGQDTEVDRAACAGLVRPQASIPCIVADCAYRWHVSAWTQCSVSCGEGIQLRHDA
CLGPRARVPVPADFCQHLPKPVTVRGCQAGPCTGQGTASPAPHEEATAPGQTAAATAASP
EWAQPHTRLLSPARGHLPRPQESPVETSVCGRQHLEPTGIIDMRGTTRPDCAAAIGRPLG
EVVTLRVLEGSLNCSAGEMLLLWGRLVWRKMCGKPAGMAFSSQANTLLVRQRLVRPGGGV
LLRYSSQPAPGAFHRGCDTQLFGPRGEILSPSMSPGGRNVGGCRIFIDVAPRARIAIHAL
TVDSGTRAEGTDASYILIRDIHSLRTTAFRGQQTLYWESEGSQAEMEFSQGFLEAHASLR
GQYWTLHTRAR
NT seq 4536 nt   +upstreamnt  +downstreamnt
atgatcgcaggcagcatggctccctccacgctggggaggtgcatgcaggggaccctcact
tctgcgctcttcctcctgagctgctgggcgctccctgatcctcggcagcagtttctgcag
gccctggagccaggggacgtgacctcttactttggccctgatgctgcctttgaagcgccc
ccattcgacgtggcctccccggcctgcgcctgcaagcacaaggacgagggcgggctggcg
gggccgccctgcagggccctgtgctgctccctggcagccctgggccggctcttctccttt
tgcttccagcctgagctgggcctgctggctgcttccttcgccagcgagctcgcggtcagt
gcctccctgtggctgctgagggggcctccccacccctgcctcacaggaggccgggccctg
ctgcccccggaggcagcagccaggctcacctactgcttgggcctcgtggagggcgacatc
ctggtgggtgcagacgggttctacatccagccgttgaggaggcagcaccgggcactggtg
catctctgggaggggggcgcgcagccccacctgatccacaggcccacccccggggccccc
accgttccagagccccgtttcacccgctttccaggaccccggctctcagccctgcccgct
ccctcaccaggccgcccccctgcccctcgcctccggagatggtcgactggacacgtcctg
cacctggagctgctggtggctgtgggtcccgacgtccagcggacccacggggaggagaca
gagcgctatgtgctcaccaacctcaacatggggtcggagctgctgagggacccatccctg
ggggctcagttccgagttcacctggtgaagatggtcatcctgacccagcctgaggatgct
ccgaagatcacagccaacatcaccgcgtcactgctgagcgtctgtgagtggagcaagaca
gtcaaccccgaggacgacacggaccctgggcatgccgacctggtcctgtacatcaccagg
tttgacctagaattgcctgatggtaaccggcaggttcggggggtcacccagctggggggc
gcctgctcctcctcctggagctgccttatcactgaggataccggctttgacctggggctc
accattgcccatgagattgggcacagctttggcctggagcacgacggtgtgccgggcagc
agctgcgggcccagcggccatgtgatggcctcggatggtgcggcgcccgccctcgccctg
gggggcccggcgtggtccccctgcagccgccggcagctgctgagtctgcttagcgcagga
cgggcgcgctgcatgtgggaccctccggcgcagcggcccgggcctgcggggcggcctccc
gaagcgcagcccggcctctactatggcgcggacgagcagtgccgcgtcgccttcggcccc
acggcggtcgcctgcaccttccgcggggagcacctggacatgtgccaggctctgtcctgc
cacacagaccccctggacccaagcagctgtagccgcctgcttattcctctcctggacggg
acagagtgtggcgtggggaagtggtgctccaagggtcactgccgctcgctggcagagctg
gcccccgtgggggtggtgcacgggcactggtctggctggggacccgccagtccttgctcc
cgctcctgtggaggcggtgtggtcaccaggaggcggcggtgtgacaaccccaggcctgcc
tttggggggcgtgcgtgcgtaggttctgacctccaggccgagatgtgcaacacacaggcc
tgtgagacgacccagctggagttcatgtccgagcagtgtgcgcagacagatggcgagccc
ctgcacctctccccggggggcagcacctccttctaccgctgggggactgcggagcagtac
agcaaagggaacgccctgtgcagacatgtgtgccgggctgttggtgagagcttcatggtg
cggcgtggggaccgtttcctggacggcacgcgctgtgtgctgggcgactctcaggaggat
ggggccctgagcctgtgcgtgtcaggcagctgcaggacgttcggctgtgatggccggatg
gactccgggcaggtgcgggacgtgtgccaggtgtgcggcggggacagcagcacgtgccgg
ccgcagaacggctccttcacggccggaagggccagagagtacgtcacattcctgaccgtc
acccccaacctcaccagcatctccgtcatcaaccgcaggcctctcttcacacacctggca
gtgaaggtgcgtggccgctacatcgtggccggaaatgggagcatctctgccagcaccagc
tacccctccctcctggaggacaaccgcgtggagtacagggtgaccctgagcgaggatcag
ctgccccgccgggaggagatccgcatctggggccccacccgggacgacatggagatccag
gtttacaggcggtacggcgaggagtacggcagccccgcccgccccgacatcaccttcacc
tacttccagcccgagcagcggcgggcctgggcgtgggccccattgcgggggccctgctcc
gtgagctgcggggcagggctgcgccaggtgacctacagctgttgggaccagtccaggagc
gagtgggtggaggctgcccgctgtgcagggagccggcccccagaggcgtggtcagaggcc
tgcaccctcgagccctgcccccctcaggatgaggcgacagacgcgtgctcgtcggcctgc
ggagcagatccggccgtgcagaacacgacgtgtatgccgggggcagatggcacggggctg
tcggcaactgctgggccctgctctgcagacgagaagccacctgccctggagccctgtgtc
gaggcggcatgtcctcccagctgggaccaggtgagcctggacgtccggtccccggggcag
gaggctgcgtccccaacaggcggccccaggctggaggcgctcgccaagcacgtgtggaca
cccctggcggggccgtgctctgcctcctgcggtcaaggcctggcggagctgcatttcgtg
tgcatggaccctgccctcaggacacccgtccgggaagagctgtgtgacctggcaagcaag
cccgggagccggcgggaggcctgccaggctgccccgtgcccggccaggtggcggtacaag
ctggcggcctgcagcctgagctgtggaggaggggtggcgcagaggatcctgtactgtgcc
cgggcccacggggaggacacggacgaggagatcctgccggacacccagtgccaggggctg
ccccgcccagagcagcaggaggcctgcagcccggagccctgcccgcccaggtggaaagtc
acgtctctcggcccgtgctcggccagctgtgggctcggcacggccactcgctcggtggcc
tgtgtgcggctggaccgcggccaggacacggaggtggacagggcagcctgcgcgggcctc
gtgcggccacaggccagcatcccttgcatcgttgccgactgcgcctaccggtggcatgtc
agcgcctggacacagtgctccgtctcctgtggggagggcatccagcttcggcacgacgcc
tgcctagggccccgggcccgggtgcctgtgcccgccgacttctgccagcaccttcccaag
ccggtgaccgtgcggggctgccaggccgggccctgcacggggcaggggacggccagcccg
gcgccccatgaggaagccactgctccaggccagaccgcagctgccacagccgcgtccccg
gagtgggcccagccccacacccgcctcctctccccagctcgaggacacctgcccaggccc
caggaaagcccagtggagaccagtgtctgtggccggcagcacctcgagccaacgggaatc
atcgacatgcgaggcacgacgcggccggactgtgcggcggccatcgggcggcccctgggt
gaagtggtgaccctccgggtcctggagggttctctcaactgcagtgctggggagatgctg
ctgctttggggcaggctcgtgtggaggaagatgtgcgggaagccggccggcatggctttc
agctcccaagccaacacgctgctggtgaggcagcgtcttgtgcggcccggaggcggagtg
ctgctacggtactcaagccagcctgccccgggagccttccaccgaggatgtgacacgcag
ctcttcggaccccggggtgaaatcttgagcccatcgatgagtccgggtgggaggaacgtg
gggggctgtcgcatcttcatcgacgtggccccgcgggccaggatcgccatccatgccctg
accgtggacagcggcaccagagctgagggaactgatgccagttatatcttgatccgggac
atccacagcctgaggacaacggcatttcgtgggcaacagacgctctactgggagtcagag
ggcagccaggcagagatggagtttagccagggcttcctggaagcacacgccagccttcgg
ggccagtactggaccctccacacaagagctcgttag

DBGET integrated database retrieval system