KEGG   Ovis aries (sheep): 101114312Help
Entry
101114312         CDS       T03117                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase isoform X4
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
oas  Ovis aries (sheep)
Pathway
oas00561  Glycerolipid metabolism
oas01100  Metabolic pathways
oas04714  Thermogenesis
oas04723  Retrograde endocannabinoid signaling
oas04923  Regulation of lipolysis in adipocytes
Module
oas_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:oas00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    101114312 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    101114312 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    101114312 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    101114312 (MGLL)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101114312 (MGLL)
Peptidases [BR:oas01002]
 Serine Peptidases
  Family S33
   101114312 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 Abhydrolase_5 Thioesterase PGAP1 BAAT_C LIDHydrolase DUF1350
Motif
Other DBs
NCBI-GeneID: 101114312
NCBI-ProteinID: XP_014957992
Ensembl: ENSOARG00000005578
UniProt: W5P6D2
Position
19
AA seq 303 aa AA seqDB search
MPEERSPRLTPQNVPYRDLPHLVNADGQHLFCRYWKPSGAPRALVFVSHGAGEHCGRYEE
LAQMLVGLGLLVFAHDHVGHGQSEGERMVVSDFHVFVRDALQHVDAVQKDHPGLPVFLLG
HSMGGAICILTAAERPGHFSGMVLISPLVVASPDSATLFKVFAAKVLNLVLPNMSLGRID
SSVLSRNKTEVDIYNSDPLVCRAGLKVCFGIQLLNAVSRVERALPKLTLPFLLLQGSADR
LCDSRGAYLLMESAKSQDKTLKIYEGAYHILHKELPEVTSSVFREINTWVSQRTAVAGAG
CPP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggaacgttcccccaggctgaccccacagaacgtcccctaccgggacctccct
cacctggtcaacgctgacggacagcacctcttctgccggtactggaaaccctcaggcgcg
cccagggcgctggtgttcgtgtcccacggggccggcgagcactgcggccgctacgaggag
ctggcgcagatgctggtggggctgggcctgctggtcttcgcccacgaccacgtcggccac
gggcagagcgaaggcgagaggatggtggtgtccgacttccacgtcttcgtccgggacgcg
ctgcagcatgtggacgccgtgcagaaggaccaccccgggctgcccgtcttccttctgggc
cactccatgggcggcgcgatctgcatcctcacggccgcggagcggccgggccacttctcg
ggtatggtcctcatctccccgctggtggtcgccagcccagactcggcgacacttttcaag
gtcttcgctgcgaaagttctgaacctcgtcctgccgaacatgtccctgggccggatcgac
tccagtgtgctctcgaggaataagacagaggtggacatctacaactcggaccccctggtc
tgccgggcggggctcaaagtctgctttggcatccagctgctcaacgcggtgtcgcgggtg
gagcgggcgctgcccaagctgacgctgcctttcctgctgctgcagggctccgccgaccgc
ctctgcgacagcagaggcgcctacctgctcatggagtcggccaagagccaggacaagaca
ctcaagatttacgaaggtgcctaccacatcctccacaaagagcttcccgaggtgaccagc
tccgtcttccgggagataaacacgtgggtctcgcaaaggacagcggtggcgggcgcaggg
tgcccgccctga

DBGET integrated database retrieval system