KEGG   Ovis aries (sheep): 101115199
Entry
101115199         CDS       T03117                                 

Gene name
RDH5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
oas  Ovis aries (sheep)
Pathway
oas00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101115199 (RDH5)
Enzymes [BR:oas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     101115199 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 101115199
NCBI-ProteinID: XP_012030186
Ensembl: ENSOARG00000011244
UniProt: A0A6P7DYJ8 W5PNM1
Position
3
AA seq 318 aa
MWLPLLLGVLLWAALWLLRDRQCLPASDAFIFITGCDSGFGRLLALRLDQRGFRVLASCL
TPSGAEDLQRVASSRLHTTLLDVTDPQSVRQAAKWVETHVGKTGLFGLVNNAGVAGIIGP
TPWQTREDFQRVLNVNTLGPIGVTLALLPLLLQARGRVINITSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAPFGVRVSIVEPGFFRTPVTNLETLEDTLQACWARLPPATQALYGEA
FLTKYLRVQQRIMNMICDPDLAKVSRCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVDAVLTWVLPKPAQTVY
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgctgctgggtgtcttgctctgggcagcactgtggttgctcagggac
cggcagtgcctgccggccagcgatgcttttatcttcatcaccggctgtgactcgggcttt
gggcggctccttgctctgaggctggaccagagaggcttccgagtcctggccagctgcctg
acaccctcgggggcggaggacctccagcgggtcgcctcctcccgcctccacaccaccctg
ctggatgtcacagatccccagagcgtccggcaggcagccaagtgggtggaaacgcatgtt
gggaaaacagggctgtttggtctggtgaataatgctggtgtggctggcatcattgggccc
accccatggcagacgcgggaggacttccagcgggtgctgaatgtgaacacgctgggtccc
atcggggtcaccctcgccctgctgcccctgctgctgcaggcccggggccgagtgatcaac
atcaccagtgtccttggccgcctggcagccaatggagggggctactgcgtctccaagttt
ggcctggaggccttctctgacagcctgaggcgagacgtggctccttttggggtacgggtc
tctatcgtggaacctggcttcttccgaacccctgtgacaaacctggaaactctggaggac
accctgcaggcctgctgggcacggctgcctccagccacacaggccctctatggggaggcc
ttcctcaccaaatacctgagagtgcagcaacgcatcatgaacatgatctgtgacccggac
ctggccaaggtgagcaggtgcctggagcacgccctaactgcccgccaccccagaacccgc
tacagcccaggctgggatgccaagctgctctggttgccagcctcctacttgccagccagc
ctggtggatgctgtgctcacctgggtccttcccaagcctgcccagacggtctactaa

DBGET integrated database retrieval system