KEGG   Ovis aries (sheep): 101115878Help
Entry
101115878         CDS       T03117                                 

Gene name
PLA2G4E
Definition
(RefSeq) cytosolic phospholipase A2 epsilon isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
oas  Ovis aries (sheep)
Pathway
oas00564  Glycerophospholipid metabolism
oas00565  Ether lipid metabolism
oas00590  Arachidonic acid metabolism
oas00591  Linoleic acid metabolism
oas00592  alpha-Linolenic acid metabolism
oas01100  Metabolic pathways
oas04010  MAPK signaling pathway
oas04014  Ras signaling pathway
oas04072  Phospholipase D signaling pathway
oas04217  Necroptosis
oas04270  Vascular smooth muscle contraction
oas04370  VEGF signaling pathway
oas04611  Platelet activation
oas04664  Fc epsilon RI signaling pathway
oas04666  Fc gamma R-mediated phagocytosis
oas04724  Glutamatergic synapse
oas04726  Serotonergic synapse
oas04730  Long-term depression
oas04750  Inflammatory mediator regulation of TRP channels
oas04912  GnRH signaling pathway
oas04913  Ovarian steroidogenesis
oas04921  Oxytocin signaling pathway
oas05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101115878 (PLA2G4E)
   00565 Ether lipid metabolism
    101115878 (PLA2G4E)
   00590 Arachidonic acid metabolism
    101115878 (PLA2G4E)
   00591 Linoleic acid metabolism
    101115878 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    101115878 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101115878 (PLA2G4E)
   04010 MAPK signaling pathway
    101115878 (PLA2G4E)
   04370 VEGF signaling pathway
    101115878 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    101115878 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101115878 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101115878 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    101115878 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    101115878 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101115878 (PLA2G4E)
   04913 Ovarian steroidogenesis
    101115878 (PLA2G4E)
   04921 Oxytocin signaling pathway
    101115878 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101115878 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    101115878 (PLA2G4E)
   04726 Serotonergic synapse
    101115878 (PLA2G4E)
   04730 Long-term depression
    101115878 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101115878 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101115878 (PLA2G4E)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101115878 (PLA2G4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2 CEP76-C2
Motif
Other DBs
NCBI-GeneID: 101115878
NCBI-ProteinID: XP_012036651
Ensembl: ENSOARG00000020466
Position
7
AA seq 831 aa AA seqDB search
MLQKQMPVWVSHYPPDSCQEDGDRPAATCALEEGLSPCHLLTVRVIRMKNVRQADVVSLT
DCFVSLWLPTASQKRLRTRTISNCRNPEWNETFSFQIQSQVKNVLELSVCDEDTVTPDDH
LLTVLYDLTKLCFRKKTHVKFPLNTEGMEELEVEFLLEESPSPPENLITNGVLVSRQMSC
LEVCAESRRPKKRKKKDLLVTVTESFEHTQRVSPCLESCCSNPACFQYPKYFQPEVHVEL
PKSPWICELCCCAGQKGPVCQSLHCLPDGQAVTLPVNENCELHMKSTPCSQVLDVRLGFS
LCQAELEFLQKRRVVVAQALKEVLQLEEDLRADEVPLIAIMATGGGTRSMTAMYGHLLAL
QKLNILNCASYITGLSGATWTMATLYRDPDWSSKSLERAILEARRHVVKDKMPALFPDQL
LKFQEELQQRRQEGYKVTFTDFWGLLIEACLGDERNECKLSDQRAALCQGQNPLPIYLTI
NVKDDVSNQDFREWFEFSPYEVGMQKYGAFIPTELFGSEFFMGRLRKRIPESRMCYMLGL
WSSIFSLNLLDAWNLSHTSEEFFHQWTRDRVHDIEDEPLLPEIPKCDANVLDTTVVTPAS
WLSNTFRDILTHRAFVSKFHNFLLGLQLHTDYLQNSQFSMWKDTVLDGFPNQLTGSVKHL
CLLDTAFFVNSSYAPLLRPERKADLIIHLNYCAGSQTKPMKQTCEYCAMQNIPFLKYELQ
KEEDNLKECYLLENAQEPDTPIVTFFPLICDTFQNYKAPGVERSPEELEQGQVDIYGPKT
PYATKELTYTEAAFDKLVKLSEYNILNNKDKLLQALRLAVERKRQKSPCPL
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgctccagaagcagatgcctgtgtgggtctcccactacccgccagactcatgccaagag
gatggggacaggcccgcggccacctgtgcattggaggaggggctgtctccatgccacctg
ctgacagtgagggtcatccgcatgaagaacgtccgacaggctgacgtggtgagcctaaca
gactgctttgtgagcctctggctgcccactgccagtcaaaagaggctgaggactaggacc
atctccaactgccgaaacccagaatggaatgaaaccttcagcttccagatccagagccaa
gtgaagaatgttctggagctgagcgtctgtgatgaagacacagtgacacctgatgaccat
ctcttgacagttctctatgacctcaccaagctctgcttccgaaagaaaacccacgtgaag
ttcccactcaacacagagggcatggaggagctggaagtggagttcctgctggaggagagc
ccctctccacctgagaacctcatcacgaacggcgtgctggtgtctcgacaaatgtcctgc
ctggaggtttgtgcagaatccaggaggccaaagaagaggaaaaagaaggacctcctggtg
acagtgacggagtccttcgagcacacccagcgcgtctcaccctgcctggagtcctgctgc
tcaaaccctgcctgcttccaataccccaaatacttccagcccgaggtgcacgtggagttg
cccaagagcccgtggatctgtgagctttgctgctgtgcgggccagaagggccctgtgtgc
cagtccctccattgcctccccgacggccaggcggtgaccttgcctgtgaatgagaactgt
gaattacacatgaagtctacaccctgttcccaggtgttggacgtgcggctgggcttcagc
ctgtgccaggcagaactggagttcctgcagaaacggagggtggtggtggcccaggcgctg
aaggaggtgctgcagctggaggaagacctgcgggcagatgaggtcccgctgatagccatc
atggccactggaggtggaacaagatctatgaccgccatgtatggccacctgctggcactg
cagaagctgaacatcctgaactgtgccagctatatcaccggcctgtctggggccacctgg
accatggccaccttgtatcgtgaccctgactggtcctccaaaagcctggagcgcgccatc
ctcgaggcacggaggcacgtggtcaaggacaagatgcctgccctgtttccagaccagctc
ctcaaattccaggaggagctccagcagcgcaggcaggaaggctacaaggtcaccttcaca
gacttctggggcctgctgattgaggcctgtctgggggatgagagaaatgaatgcaaactg
tcagatcagcgtgctgctttgtgccagggccagaaccccctgcccatctacctcaccatc
aatgtcaaggatgatgtaagcaaccaggatttcagagagtggttcgagttctccccctac
gaggtgggcatgcagaagtatggagccttcatccccacagagctcttcggctccgagttc
ttcatggggcggctgaggaagagaatcccagagtcgcggatgtgctacatgctaggtttg
tggagtagcatcttctccctgaacctgcttgacgcctggaacctatcccacacctcggag
gagtttttccaccagtggacaagggatagagtgcatgatattgaagacgagccactcctg
cctgaaatccccaaatgtgatgccaacgtcctggacaccacagtggtgacaccagcatcc
tggctgtccaacactttccgcgacatcctcacccacagggcctttgtctccaagttccac
aatttcctgctggggctgcagctgcacactgactacctccagaacagccagttctccatg
tggaaagacacggtgctggacggcttcccaaaccagctgacaggatctgtgaaacacttg
tgcctgttggacaccgcattctttgtcaactccagctacgcgcccctcctcaggcccgag
agaaaagctgacctcatcatccaccttaattactgtgctggctcccagacaaagcccatg
aagcaaacctgcgagtactgcgccatgcagaacatccccttcctcaaatacgagctgcaa
aaggaggaggataacctcaaggagtgctacctgctggagaacgcccaggagcccgacacc
cccatcgtgacctttttcccactcatctgcgacaccttccaaaattacaaggccccaggt
gtggaacgaagccctgaggagctggagcagggccaggttgacatctacggtcccaaaact
ccctacgccaccaaggagctgacatacactgaggccgccttcgacaagctggtgaagctt
tccgagtataacatcctgaataacaaggacaagctccttcaggccttgcgactggcagta
gagaggaaacgccagaagagcccgtgtcccctctaa

DBGET integrated database retrieval system