KEGG   Ovis aries (sheep): 101116072Help
Entry
101116072         CDS       T03117                                 

Gene name
NMNAT1
Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
oas  Ovis aries (sheep)
Pathway
oas00760  Nicotinate and nicotinamide metabolism
oas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    101116072 (NMNAT1)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     101116072 (NMNAT1)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     101116072 (NMNAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like ChapFlgA DUF4258
Motif
Other DBs
NCBI-GeneID: 101116072
NCBI-ProteinID: XP_004013785
Ensembl: ENSOARG00000006756
UniProt: W5P9X8
Position
12
AA seq 281 aa AA seqDB search
MENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGKYKVIKGIISPVGDAYKKKGL
ISACHRVIMAELATKNSKWIEVDTWESLQKEWTETAKVLRHHQEKLEASICDPQQNSPVL
EKPGRKRKWAEQKQDFSEKKSLEQTKTKGVPKVKLLCGADFLESFGVPNLWKSEDITKIL
GDHGLICITRAGNDAQKFIYESDVLWKHQNNIHLVNEWITNDISSTKIRRALRRGQSIRY
LVPDLVQEYIEKHNLYSSESEERNVGVVLAPLQRNTTEVKA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggagaactcagagaagacagaagtagttctccttgcttgtgggtcctttaatcctatc
accaacatgcacctccggctgtttgagctggccaaggactacatgaatggaacaggaaaa
tataaagttatcaaaggcataatttctccagtcggcgatgcatataagaagaaaggactc
atctctgcctgtcaccgagttatcatggcagaacttgccaccaagaactcaaaatggata
gaagttgatacatgggaaagtcttcagaaagagtggacagagacagccaaggtgctaaga
caccatcaagagaagctggaggccagtatctgtgatccccagcagaactcacccgtgctg
gaaaagcctggacggaagagaaagtgggctgaacaaaaacaagattttagtgaaaagaaa
tccctagagcaaacaaaaacgaaaggtgtgccaaaggtgaagctgctgtgtggagcagat
tttttggagtcctttggtgtgcccaatctatggaagagtgaggatatcaccaaaatcctg
ggagaccacgggctcatatgtattactcgggctgggaatgatgcccagaagttcatctac
gaatccgacgtactgtggaaacaccagaacaacattcacttggtgaacgaatggatcacc
aatgacatctcctccacgaagatccggcgagccctcaggaggggccagagcattcgctac
ttggtccccgatcttgtacaagaatatattgaaaagcataatctgtatagctctgagagt
gaggagaggaatgttggagtggtcctggctcctttgcagagaaacactacagaagttaag
gcataa

DBGET integrated database retrieval system