KEGG   Ovis aries (sheep): 101116327Help
Entry
101116327         CDS       T03117                                 

Gene name
CARS2
Definition
(RefSeq) probable cysteine--tRNA ligase, mitochondrial isoform X1
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
oas  Ovis aries (sheep)
Pathway
oas00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    101116327 (CARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:oas01007]
    101116327 (CARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:oas03016]
    101116327 (CARS2)
Enzymes [BR:oas01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     101116327 (CARS2)
Amino acid related enzymes [BR:oas01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   101116327 (CARS2)
Transfer RNA biogenesis [BR:oas03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    101116327 (CARS2)
 Prokaryotic Type
    101116327 (CARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f DALR_2
Motif
Other DBs
NCBI-GeneID: 101116327
NCBI-ProteinID: XP_027829593
Ensembl: ENSOARG00000006892
Position
10
AA seq 555 aa AA seqDB search
MLGTRRVCAAAWLLRAAPGPEPGRSASGARGQGWLQPAGYDTGVKVYNSLTRRKDPLIVS
RADAASWYSCGPTVYDHAHLGHACSYVRFDIIRRILTRVFGCGVVMVMGITDVDDKIIRR
ANEMSVSPASLARLYEEDFKQDMAALKVLPPTAYLRVTEHVPQIVTFIERLIANGHAYCT
AKGNVYFDLQSRGDRYGKLVGVAPVPAGEPVDSDKRHASDFALWKAAKPQEPFWGSPWGN
GRPGWHIECSTIASLVFGSRLDIHSGGVDLAFPHHENEIAQCEAFHQCPQWGNYFLHSGH
LHVKGGGEKMSKSLKNYITIKDFLRSASPDVFRLFCLRSSYRSAVDYSEGALLEARRLLR
ATAAFVEDARAYVRGQLAGGPVQEDVLWERLGRTKAAVQAALADDFDTVRAVDAVMDLVH
HGNRQLKAAAEEPRGARSPAVLGAIVASVEQFFETVGISLAERQCVPGAGSPAALHSLVE
ELVRFRLKVRQFALASGEAPGEARQQRLLERQPLLEACDTLRRDLAVHGISIKDRSGSST
WELLDQRTQDPKPRS
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgctggggacgcgccgggtctgcgcggccgcttggctgctccgggccgcgccgggccct
gagccgggccgctcggcgtcgggggcgcgcgggcagggctggctgcagcccgcgggctac
gacacgggcgtcaaggtgtacaacagcctcacccggaggaaggacccgttgattgtgagc
cgcgcggacgccgcctcctggtatagctgtggaccaactgtctacgatcacgcacacctg
ggtcatgcttgctcctacgtcaggtttgatataatccgaaggatcctcaccagggtgttt
ggatgcggcgtcgtcatggtgatgggaatcacggacgtggatgataagataatcaggcgc
gccaacgagatgagcgtgtcgcccgcgtccctggcccgtctttacgaagaagacttcaaa
caggacatggcagccctgaaggtcctcccacccaccgcctacctacgggttaccgagcac
gtgcctcagatcgtcaccttcatcgagagactcatcgccaacgggcatgcttactgcaca
gcaaaaggcaacgtctacttcgacctgcagtcgcgaggcgacaggtacggcaagctggtt
ggcgtggcacccgtgccggcgggagagccagttgactccgacaagcggcatgccagcgac
ttcgcactgtggaaggcggcgaagccccaggagcctttctggggctccccgtggggcaac
gggaggcccggctggcacatcgagtgttccaccatcgccagtctggtgttcgggagtcgg
ctggacatccactcgggcggcgtggacctggcgttcccgcaccacgagaacgagatcgcc
cagtgcgaggccttccaccagtgcccgcagtggggcaactacttcctgcattccgggcac
ctgcacgtgaagggtggaggagagaagatgtccaagtcgctcaagaactacatcaccatt
aaggacttcctccgctccgcctctccagacgtcttccgcctcttctgcctgcggagcagc
tacaggtcagccgtcgactacagcgagggcgccctgctggaggccaggcgcctgctgcgg
gccacggccgccttcgtggaggatgcacgggcctacgtgagggggcagctggccggtggc
cccgtccaggaggacgtgctatgggaaaggctgggccgcaccaaggcggccgtgcaggca
gccttggcggacgacttcgacactgtgcgggcggtggatgccgtcatggacctcgtccac
catgggaacaggcagctgaaggcggctgccgaggagccccgtggtgcccggagccccgcc
gtgctgggggccatcgtggcctccgtggagcagttctttgagacggtgggcatttctctg
gccgagcgacagtgtgttccaggggcgggcagcccggccgccttgcacagcctggtggag
gagctggtccgcttccggctgaaggtccgacagttcgctctggcctccggggaggcccct
ggggaggcgaggcagcagcggctcctggagcggcagcccctgctggaggcctgcgacacg
ctgcgcagggacctggctgtccacggcatcagcatcaaggacaggagcggctcgtccacg
tgggagctgctggatcagaggacacaagaccccaaacccaggagctga

DBGET integrated database retrieval system