KEGG   Ovis aries (sheep): 101118833Help
Entry
101118833         CDS       T03117                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
oas  Ovis aries (sheep)
Pathway
oas00010  Glycolysis / Gluconeogenesis
oas00562  Inositol phosphate metabolism
oas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101118833 (MINPP1)
   00562 Inositol phosphate metabolism
    101118833 (MINPP1)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     101118833 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     101118833 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 101118833
NCBI-ProteinID: XP_004020059
Ensembl: ENSOARG00000013967
Position
22
AA seq 486 aa AA seqDB search
MHRGACSLVRVSATPVAALAVALLSSLSRCSLLEPENSVVSALSPYFGTKTRYEDVNPGL
LPDPEAPRRDPELLEEACTPVQLVALIRHGTRYPTTKQIRKLRQLHGLLQARGAEDDRTR
AAGRGDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLQLV
TSSKHRCVDSGAAFLQGLWQHYHPGLPPPDVADMECGPPRINDKLMRFFDHCEKFLTQVE
RNATALYHVEAFKTGPEMQNILKKVADILQVPVNNLNADLIQVAFFTCSFDLAIKGVKSP
WCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVKQKQCSQPV
SSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKEQMHRKFRSGHIVPYASNLIFVLY
HCKNAKTPKEEFRVQLLLNEKVLPLAHSQETVSLYEDLKNHYKDILQSCHTSEECELPKV
NTSDEL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcggcgcgtgcagcctcgtcagggtctccgcaacgcccgtcgcggccctggct
gtggcgctgctctcgtcgctctctcgctgctccctcctggagccggagaacagtgtggtc
tccgcgctcagcccctacttcggcaccaagactcgctatgaggatgtcaaccccgggctg
ctgccggaccccgaagcgccgcggcgggacccggagttgttagaggaagcctgcaccccg
gtgcaactggtcgccctcatccgccatggcacccgctacccgacgaccaaacagatccgc
aagctgcggcagctgcacgggctgctgcaggcccgcggggccgaggatgaccggactcgc
gctgccggccgcggcgacctgggcgccgcgctggccgactggccgctatggtacgctgac
tggatggacgggcagctggtggagaaggggcggcaggacatgcgacagctggccctgcgc
ctggcctcccttttcccagccctcttcagcagagagaactacggccgcctgcagctagtc
accagctccaagcaccgctgcgtggacagcggcgccgccttcctgcaagggctctggcag
cactaccacccggggttaccgccacccgatgtcgcagatatggagtgtggacctccaaga
attaatgataaattaatgaggttctttgatcattgtgagaagtttttaactcaagtggaa
aggaatgctactgctctttatcatgtagaagccttcaaaactggaccagaaatgcagaac
attttaaaaaaagttgcagatattttgcaagtgccagtcaacaacttaaatgcagattta
attcaggtagcttttttcacctgttcctttgacctggcaattaaaggtgttaaatctcct
tggtgtgatgtttttgacatagatgatgcaaaggttttagaatatttaaatgatctgaaa
cagtattggaaaagaggatatggatatacgattaacagtcgatccagctgcaccctgttt
caggatatctttcagcacttggacaaagcagttaaacagaaacaatgttctcaaccagtt
tcctctccagtcatcctccagtttggccatgcagagacccttcttccactgctttctctc
atgggctacttcaaagacaaggaacccctaacagcttacaattacaaggagcaaatgcat
cggaagttccgaagtggtcacattgtaccctatgcttcaaacctgatatttgtgctttac
cattgtaaaaatgctaagactcctaaagaagaattccgagtgcagttgttactgaatgaa
aaagtgttaccattggctcactcacaagaaactgtttctttgtatgaagatctgaagaac
cactataaggacatccttcagagttgtcataccagtgaagaatgtgaactaccaaaggtg
aacacatctgatgagctatga

DBGET integrated database retrieval system