KEGG   Ovis aries (sheep): 101119477Help
Entry
101119477         CDS       T03117                                 

Gene name
PARP16
Definition
(RefSeq) protein mono-ADP-ribosyltransferase PARP16 isoform X2
  KO
K00774  poly [ADP-ribose] polymerase 16 [EC:2.4.2.30]
Organism
oas  Ovis aries (sheep)
Brite
KEGG Orthology (KO) [BR:oas00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101119477 (PARP16)
Enzymes [BR:oas01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     101119477 (PARP16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP ARTD15_N
Motif
Other DBs
NCBI-GeneID: 101119477
NCBI-ProteinID: XP_004010280
Ensembl: ENSOARG00000017858
Position
7
AA seq 322 aa AA seqDB search
MQPAGWAAVREAAGRDVLAADLRCSFFASALRSYKRDSVLRPFPASYARHDCKDFEALLA
DASKLPNLKELLQSSGEKDPSAWDLMSWILSSKVLTIHSAGKSEFEKIQKLTGTPHTPVP
VPDFLFEIEYSDPANAKFYETKGERDLIYAFHGSRLENFHSIIHNGLHCHLNKTSLFGEG
TYLTSDLSLALIYSPHGHGWQHSLLGPILSCVAVCEVIDHPDVKCQTKKKDSKEIDRRRA
RIKHSEGGDVPPKYFVVTNNQLLRVKYLLVYSQKQPNRASSQLSWVSSHWFTVMITLYLL
LLLAVSVINSSAFQHFWNRAKR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccgcggggtgggcggccgtcagggaggcggcaggccgcgacgtgctggccgcc
gacctgcgctgcagcttcttcgcctcggccctgcggagctacaagcgcgactcagtgctg
cggcccttccccgcgtcctatgcccgccacgactgcaaggacttcgaggctctgcttgca
gatgccagcaagttacctaacctgaaagaacttctccagtcctcaggagaaaaagaccca
tcggcctgggacctgatgagctggattttatcgtcaaaggtcctgacaatccacagtgca
gggaagtcagagtttgaaaagatccaaaagctgactggtacccctcacacgcctgtcccc
gtgccggacttcctgtttgaaatcgagtactccgacccagccaacgccaaattttatgag
accaaaggagaacgcgacctcatctacgccttccatgggagccgcctagagaacttccat
tccatcatccacaatggcctgcactgccacctgaacaagacatccttgtttggggaaggg
acctacctcaccagtgacctgagcctggccctcatttatagcccccatggccacgggtgg
cagcacagtctccttggccccatccttagctgcgtggctgtgtgcgaggtcattgaccat
ccagacgtcaagtgccaaacgaagaagaaggattccaaggagatagatcgcaggagagcg
agaatcaagcacagtgaagggggcgacgtccctccaaagtactttgtggtcactaataac
cagctcttgcgcgtgaagtacctgctggtgtactcgcagaagcagcccaacagggcttcc
agccagctctcctgggtctccagccattggtttacggtcatgatcaccctgtatctgctg
ctgctgctcgcagtgagtgtcatcaactcctcagctttccaacacttctggaatcgtgcg
aagagataa

DBGET integrated database retrieval system