KEGG   Ovis aries (sheep): 101119818Help
Entry
101119818         CDS       T03117                                 

Gene name
DOCK6
Definition
(RefSeq) dedicator of cytokinesis protein 6 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
oas  Ovis aries (sheep)
Brite
KEGG Orthology (KO) [BR:oas00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oas04131]
    101119818 (DOCK6)
Membrane trafficking [BR:oas04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    101119818 (DOCK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 101119818
NCBI-ProteinID: XP_027825474
Ensembl: ENSOARG00000017948
Position
5
AA seq 2123 aa AA seqDB search
MAAAERRAFAHKINRTVAAEVRKQVSRERSGSPHSSRRCSSSLGVPLTEVVEPLDFEDVL
LSRPPDVEPGPLRDLVEFPADDLELLLQPRECRTTEPGIPEDGKMDAQVRAAVEMYTEDW
IIAHRRYQHLSAAYNPITTETQRERQKGLTRQVFEQDASGDERSGPEDSDDPRHSSGSLD
DTPRSSGASGIFDLRNLAADSLLPSLLERVAPEDVDRRNEALRRQHRPRALLALYPAPDE
DEAVERCNRPEPPREHFGQRILVKCLSLKFEIEIEPIFGILALYDVREKKKISENFYFDL
NSDSMKGLLRAHITHPAISTLARSAIFSVTYPSPDIFLVIKLEKVLQQGDISECCEPYMV
MKEADTAKNKEKLEKLRLAAEQFCTRLGRYRMPFAWTAVHLANIVSSAGQPDRDSDSEGE
RRPAWTDRRRRGPQDRTSSGDDACSFSGFRPATLTVTNFFKQEAERLSDEDLFKFLADMR
RPTSLLRRLRPVTAQLKIDISPAPENPHFCLSPELLHVKPYPDPRGRPTKEILEFPAREV
YAPHTSYRSLLYVYPHSLNFSSRQGSVRNLAVRVQYMAGEDPSQALPVIFGKSSCSEFTR
EAFTPVVYHNKSPEFYEEFKLRLPACVTENHHLLFTFYHVSCQPRPGTALETPVGFTWIP
LLQHGRLRTGPFCLPVSVDQPPPSYSVLTPDVALPGMRWVDGHKGVFSVELTAVSSVHPQ
DPHLDKFFTLVHVLEEGAFPFRLKDAVLSEGTVEQELRASLAALRLASPEPLVAFSHHVL
DKLVRLVVRPPVIGGQIVNLGRGAFEAMAHVVSLVHRSLEGAQDTRGHCPLLAAYVYYAF
RLPGTEPSLPGGAPPVMVQPATLARGPGRPASLYLARSKSISSSNPDLAVAPGSVDDEVS
RILASKGIDRSHSWVNAAYAPGGSKAVLRRAPPYCGADPRQAIDRSSSRTSSCLESSSSS
PPTTQPRPTVQKLLHEELALQWVVSGSAVREAVLQHAWFFFQLMVKSMTLHLLLGQKLDT
PRKLRFPGRFLDDIAALVGSVGLEVITRIHKDAELAERLNASLAFFLSDLLSLVDRGFVF
SLVRALYKQVATRLQSAPNPAVLLTLRMDFTRILCSHEHYVTLNLPCCPLSPPASPSPSV
SSTASQSSTFSSQAPDPKVISMFELSGPFRQQHFLAGLLLTELALAMEPEAEGASLLHKK
AICAVHSLLCSHDADPRYAEATVKARVAELYLPLLSLARDTLPRLHDFAEGPGQRSRLAS
MLDSDTEGEGDVGGTINPSVAMAIAGGPLAPGSRASISQGPATAARSGYALSAESSRTLL
VCALWVLKNAEPALLQRWAADLTLPQLGRVLDLLYLCLAAFEYKGKKAFERINSLTFKKS
LDMKARLEEAILGTIGARQEMVRRSRERSPFGNQENVRWRKSVTHWRQTSDRVDKTKDEM
EHEALVDGNLATEASLVVLDTLEIIVQSLRAGFLACQTVMLSEARESILGAVLKVVLYSL
GSAQSALFLQHGLATQRALVSKFPELLFEEDTELCADLCLRLLRHCGSRISAIRTHASAS
LYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTTQNFSEEHLRRSLKTILTYAEEDVGLRD
STFAEQVQDLMFNLHMILTDTVKMKEHQEDPEMLIDLMYRIARGYQGSPDLRLTWLQNMA
GKHAELGNHAEAAQCMVHAAALVAEYLALLEDSRHLPVGCVSFQNISSNVLEESAISDDI
LSPDEEGFCSGKHFTEMGLVGLLEQAAVYFTMGGLYEAVNEVYKTLIPILEAHRDYKKLA
AVHGKLQEAFTKIMHQSSGWERVFGTYFRVGFYGARFGDLDEQEFVYKEPSITKLAEISH
RLEEFYTERFGEDVVEIIKDSNPVDKTKLDPQKAYIQITYVEPHFDTYELKDRVTYFDRN
YGLRTFLFCTPFTPDGRAHGELPEQHKRKTLLSTAHAFPYIKTRIRVCHREETVLTPVEV
AIEDMQKKTRELAFATEQDPPDAKMLQMVLQGSVGPTVNQGPLEVAQVFLAEIPEDPKLF
RHHNKLRLCFKDFCKKCEDALRKNKALIGPDQKEYHRELERNYSRLREALQPLLTQRLPQ
LLAPNTAGLRNSLNRASFRKTDL
NT seq 6372 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgccgagcgccgcgccttcgcgcacaagatcaacaggacggtggctgccgaa
gtgcgaaagcaggtgtcccgggaacgcagcggctctccccattccagccggcgctgcagc
agctccctgggggtcccactgaccgaagtcgttgagcccctggattttgaggatgtgctt
ctgagccggccgccggatgtagagcctgggcctctccgggatctggtcgagtttccagct
gatgacctagagctacttctgcagccccgggaatgccgcaccacggagcccggtatcccc
gaggatggaaagatggatgcccaggtgagagctgccgtggaaatgtacactgaggactgg
atcattgcccataggagataccagcacctgagtgcggcgtacaaccccatcaccacggag
actcaacgagagaggcagaaggggctcacccgccaggtcttcgagcaggacgcttctggg
gatgagaggtccggccccgaggactcggatgacccccgacactcctcaggttccctggac
gacaccccacgaagcagtggtgcctctggcatcttcgacctgaggaacttggcggcggat
tctttgctaccctccctcctggagcgcgtggccccagaggacgtggaccggcgtaatgag
gcattgcggcggcagcaccggccccgcgccctgctggcgctctaccccgcccccgacgag
gatgaggctgtggaacgctgcaaccgcccagagccaccgcgagagcactttggacagagg
atcctggtcaagtgcctgtcgcttaagttcgagattgaaatcgagcccatctttggcatc
ttggccctatacgatgtgcgagagaaaaagaagatctcagagaatttctactttgatctg
aactcggactccatgaaggggctactgcgggcccacatcacccatcctgccatctcgacc
ctggcccgctctgctatcttctctgtgacctacccctcgcctgacatcttcttggtcatc
aagctggagaaggtgctgcagcaaggagacattagcgagtgctgcgagccctacatggtg
atgaaggaggcggacacagccaagaacaaagagaagctggagaagctgcgcctggcggct
gagcagttctgcacccgtctgggccgctatcgcatgcccttcgcctggacggctgtgcac
ctggccaacatcgtgagcagcgccggccagccagaccgcgactcagactcagagggcgag
cgccgaccagcctggactgaccgccgccgtcggggaccccaggaccggacgagtagtggg
gacgacgcttgcagcttctctggtttccgcccagccacactaaccgtcaccaacttcttt
aagcaggaggctgagcggctcagtgacgaggacctcttcaagttcctggctgacatgcgg
cgcccgacatccctgttgcgacgcctgcgtcccgtgaccgcccagctcaagatcgacatt
tccccggcccctgagaaccctcacttctgcctctccccggagctgcttcacgtcaagccc
tacccagacccgaggggccggcccaccaaggagatcctggagttccctgcccgtgaggtc
tatgccccccacaccagctacaggagcctgctgtacgtgtacccacacagcctcaacttc
agcagccgccagggctccgtgcgcaacctcgccgtgcgagtgcagtacatggcaggcgag
gaccccagccaggccctgccggtcatctttggcaagtctagctgcagtgaatttacccgt
gaagccttcacaccggtggtctaccataacaagtctcccgagttctacgaggagttcaag
ctgcgtcttcccgcctgcgtgactgagaaccaccatctgctcttcaccttctaccacgtc
agctgccagccccggcctggcacggccctggagactcctgtgggcttcacttggatccca
ctgctgcagcacggccgcctgaggacaggccccttctgcctccccgtgtcggtagaccag
cccccgcccagctactccgtgctcacaccggatgtggcgctgccgggcatgcgctgggtg
gatggtcacaagggcgtgttcagcgtggagctcacagccgtgtcctctgtgcatccccag
gacccccacctggacaagttcttcaccctggtgcacgtcctggaggagggggcctttccg
ttccggctgaaggacgcggtgctgagcgagggcactgtggagcaggagctgcgggccagc
ctggcggccctgcgcctcgccagccccgagcccctcgtcgccttctcccaccatgtactg
gacaagctcgttcgtctggttgtgcgacccccggtcattggtggccagattgtgaacctg
ggtcgtggcgcctttgaagcaatggcccacgtggtcagcctcgtccaccggagcctagag
ggtgcccaggacacccgtggtcactgcccactgctggctgcatatgtctactatgccttt
cgactgcctggcacagagcccagcctcccaggtggggcccctccagtgatggtgcagcct
gccacgctggcccgtggccctggccgccccgccagcctctacctggcacgctctaagagt
atcagcagcagcaaccccgacctggccgtggcccctggctctgtggatgacgaggtctcc
cgcatcctggccagcaagggtatcgaccgctcacactcctgggtgaatgctgcttatgct
ccgggaggcagcaaggctgtgctgcgacgggcccccccttattgcggggctgaccccaga
caggccatcgaccgcagctctagccgaacctcttcctgcctcgagagctcctcctcgtcc
ccgcccaccacccagccgagacccactgtgcagaagctgctacatgaggagctggccctg
cagtgggtggtcagcggcagtgctgtgcgcgaagccgtcctgcagcacgcctggttcttc
ttccagctcatggtgaaaagcatgacgctgcacctgctcctgggtcagaagctggacaca
ccccgcaaacttcgcttccctggacgcttcctggacgacattgcagccctggtgggctct
gtaggcctggaggttatcacccgcatccacaaggacgcggagctggccgagcgcctcaac
gccagcctggccttcttcctcagcgacctgctgtccctggtggaccgcggcttcgtcttc
agcctggtccgggctctctacaagcaggtggccacacggctgcagtcggcccccaacccg
gcagtactgctgaccctgcgcatggacttcacgcgcatcctgtgcagccatgagcactac
gtgaccctcaacctcccctgctgccctctgtcgccccccgcctcgccttcgccctctgtg
tcctccaccgcctcccagagctccaccttctccagccaggccccagaccccaaggtgatc
agcatgttcgagctgagcgggcctttccggcagcagcatttcctggctgggctcctgctg
acggaactggccttggccatggaacctgaggccgagggggcgtccctgctgcacaagaag
gccatctgtgctgtccacagcctgctctgcagccatgacgccgacccccgctatgccgag
gccaccgtgaaggcccgggtggccgagctatacctgccactgctgtcactcgcccgggac
acgctgccacggctgcatgactttgccgagggcccaggtcaacgctcaaggctggcctct
atgctcgactcggacacagaaggggaaggggatgtgggaggcaccatcaacccctcggtg
gccatggccattgcaggtggccccctggcccctggctcccgggctagtatctcccagggc
ccagcgacggctgctcgctcaggctatgccctctctgctgagtccagtcggaccttgctg
gtgtgtgcgctatgggtcctgaagaacgctgagccggccctgctgcagcgctgggctgcg
gacctgaccctccctcagctgggtcgtgtcttggacttgctgtacctctgcctggctgcc
tttgagtacaaggggaagaaggcctttgaacgcatcaacagcctcacattcaagaaatcg
ctggacatgaaggcccgactggaggaagctattttgggcaccattggagcccgacaggag
atggtgcgacggagccgtgagaggagcccatttgggaaccaggagaacgtacgctggcgg
aagagcgtcacacactggagacaaacctcggaccgtgtggacaagaccaaggatgaaatg
gaacacgaggccttggtagacgggaacctggcaaccgaggcaagcctggtggtcctggat
acactggagatcatcgtgcagtctctaagagctggatttctggcctgccagacggtgatg
ctgtcagaggcccgggagagcatcctaggcgcggtactgaaggtcgtgttatacagcctg
ggcagcgcgcagagtgccctcttcctgcagcacggcctggccacacagcgggctctggtg
tccaagttcccagagctgctgtttgaggaggacacggagctgtgtgctgacctctgcctg
aggctcctgcgccactgcggcagccgcatcagcgccatccgcacccatgccagcgcctcc
ctctacctcctcatgcgccagaacttcgagatcggcaacaatttcgcccgtgtgaagatg
caagtgacgatgtcgctgtcgtccctggtgggaacaacacagaacttcagtgaagagcac
ctgcggcgctcactcaagaccatcctcacctatgccgaggaggacgtggggctgcgggac
agcacctttgccgagcaggtccaggacctgatgttcaacctgcacatgatcctgactgac
acggtgaagatgaaggagcatcaggaagacccggagatgcttatcgacctcatgtacagg
atcgcccggggctaccagggctccccagacctgcggctgacgtggctgcagaacatggcg
gggaagcacgcggagctgggcaaccacgcggaggccgcgcagtgcatggtgcacgcggcc
gccctggtggccgagtacctcgcgctgttggaggacagccgccacctgcctgtgggctgc
gtttccttccagaacatctcgtccaacgtgctggaggagtccgccatctccgacgacatc
ctctcacccgacgaggagggcttctgttccgggaagcacttcacggagatggggctggtg
gggctgctggagcaggcggccgtctacttcaccatgggcgggctctacgaggccgtgaac
gaggtctacaagaccctcattcccatcctggaagcccaccgcgactacaagaagctagct
gccgtgcacggcaaacttcaggaggccttcaccaagatcatgcaccagagttccggctgg
gagcgcgtgtttgggacatatttccgtgtgggcttctacggcgcccgctttggtgacttg
gatgagcaggagttcgtgtacaaggagccatctatcacgaagctggctgagatttcacac
cggctagaggagttctacacggagaggttcggggaggatgtggtcgagatcatcaaagat
tctaaccctgtggacaagaccaagctggacccgcagaaggcctacatccagatcacatac
gtggagccgcactttgacacctatgagctcaaggaccgggtgacctacttcgaccgcaac
tatgggctgcgaaccttcctgttttgcacacccttcacgccagacgggcgtgctcacggc
gaactgccagagcagcataagcgcaagacactgctgagcacggcccacgccttcccctac
atcaagacccgaatccgtgtttgccaccgggaggagacggtgctgaccccagtggaggtg
gccatcgaggacatgcaaaagaagactcgggagctggccttcgccactgagcaggaccct
cctgatgccaagatgctgcagatggtgctgcagggctctgtggggcccactgtgaaccag
ggacctctggaggtagcccaggtgtttctggcagagatcccagaagaccccaagctcttt
aggcatcacaacaagctgcggctctgtttcaaagacttctgcaaaaagtgtgaggatgcg
ctgcggaagaacaaagccctgattgggccggaccagaaggagtaccatcgggaactggag
cgcaactattcccgcctacgggaggctctgcagcctttgctcacccaacgcctgccccag
ctgctggcaccaaacacagccggcctcaggaactccttgaacagagcaagtttccggaag
actgacctctga

DBGET integrated database retrieval system