KEGG   Ovis aries (sheep): 101119853Help
Entry
101119853         CDS       T03117                                 

Definition
(RefSeq) 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase
  KO
K07431  sterol 12-alpha-hydroxylase [EC:1.14.18.8 1.14.14.139]
Organism
oas  Ovis aries (sheep)
Pathway
oas00120  Primary bile acid biosynthesis
oas01100  Metabolic pathways
oas03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    101119853
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101119853
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:oas00199]
    101119853
Enzymes [BR:oas01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.139  5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase
     101119853
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.8  7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase
     101119853
Cytochrome P450 [BR:oas00199]
 Cytochrome P450, animal type
  CYP8 family
   101119853
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 101119853
NCBI-ProteinID: XP_011954841
Ensembl: ENSOARG00000014043
UniProt: W5PX83
Position
19
AA seq 499 aa AA seqDB search
MVLWGPVLAALLVVIVGYLCLRGLLRQRRPKEPPLDKGPMPWLGHAMAFRKNMFEFLRHM
QAKHGDIFTVQLGGQYFTFVMDPLSFGPILKDAQRKLDFVEYAQKLVLKVFGYRSVQGDY
RMIHSASTKHLMGEGLEELNKVMLDTLSLVMLGPTGPSLDTHHWREDGLFHFCYNILFKA
GYLSLFGYTKDKEQDLLQAEELFLEFRKYDRLFPRFVYSLLGPREWLEVGRLQRLFHKEL
SVEHNLEKYGVSNWITYMLQFLREQGVSPAMQDKFNFMMLWASQGNTGPTSFWALLFLLK
HPEAMRAVREEATRLLGEVRLEAKQSFKFGALHRMPVLDSVMEETLRLRASPTLLRVVND
DQILQMASGQEYLLRNGDILALFPYLSVHMDPDIHPEPTAFKYDRFLTASGSRKVDFYKA
GKKIRHYTMPWGSGVSICPGRFLALNEMKLFILLMVMNFDLELVDPDTPVPPVDPQRWGF
GTTQPSHEVRFRYRLRPVE
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctggggtccggtgctggcagccctgctagtggtcattgtgggatacctgtgc
ctgcgggggctgctccggcaacgaagacccaaggagccccctctggataagggccccatg
ccctggctgggccatgctatggctttccggaagaatatgttcgaatttctgaggcacatg
caggccaaacatggggacatattcacagtacagctagggggccagtacttcacctttgtc
atggaccctctgtcttttggccccatcctcaaggatgcgcagaggaagctagacttcgtg
gagtatgcgcaaaaactggtgctaaaggtatttggataccgctctgtgcagggagactat
aggatgatacactcagccagcaccaagcacctcatgggggaaggcttggaggagctcaac
aaagtcatgttagacaccctgtccttggttatgctggggcccacaggccccagtctggac
acccaccactggcgtgaggatggcctctttcacttctgctacaacatcttgttcaaggct
ggctacctgagcttgttcggctacacaaaggacaaggagcaggacctgctgcaggcagag
gagctattcctggagtttcgcaagtatgaccgcctgttccccaggtttgtttactccctg
ctggggccccgggagtggctagaagtgggccggctccagcgtctcttccataaggaactc
tcggtggaacacaacctggagaagtacggcgtaagcaactggatcacctacatgcttcag
tttctgagggagcagggcgtctccccggccatgcaggacaagttcaacttcatgatgctc
tgggcctcccagggtaacacagggccgacctccttctgggccctcctgttcctcctgaag
cacccagaggccatgcgggctgtgagggaggaggccacccggctcctgggagaggtcagg
ctggaggctaagcagtcctttaagtttggtgccctgcaccgcatgccggtgctggacagt
gtgatggaagagacactgcggctgagggcctcgcctaccctcctcagggtggtgaacgat
gaccagatcctgcagatggccagtgggcaggagtacctgctccgcaatggagacatcctg
gccctcttcccttatctctcagtgcacatggaccccgacatccaccctgagcccaccgcc
ttcaagtacgatcgcttcctcaccgccagcggcagccgaaaagtagacttctacaaggca
ggcaagaagatccgccactataccatgccgtggggctcaggtgtctccatctgccctggg
aggttcttggccctcaacgagatgaagctctttatcctgctcatggtcatgaactttgac
ctggagttggtggaccctgacacacctgtaccacccgtggacccccagcgctggggcttt
ggcaccacacagcccagccacgaggtgcgatttcgctaccgcctgcggcctgtggagtga

DBGET integrated database retrieval system