KEGG   Ovis aries (sheep): 101120562
Entry
101120562         CDS       T03117                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
oas  Ovis aries (sheep)
Pathway
oas04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:oas00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101120562 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oas04040]
    101120562 (ASIC1)
Ion channels [BR:oas04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   101120562 (ASIC1)
SSDB
Motif
Pfam: ASC EFP
Other DBs
NCBI-GeneID: 101120562
NCBI-ProteinID: XP_004006416
Ensembl: ENSOARG00000018049
UniProt: W5Q9I4
Position
3
AA seq 526 aa
MELKAEEEEVGGLQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV
CTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN
RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCS
AEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETS
FEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDLDFF
DSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEYCV
CEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQ
KKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSADK
GVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggaactgaaggctgaggaggaggaggtgggtggcctccagccggtgagcatccaggcc
ttcgccagcagctccaccctgcacggcctggcccacatcttctcctacgagcggctgtct
ctgaagcgggcgctctgggccctctgcttcctgggctccttggctgtgctgctgtgtgtg
tgcaccgagcgtgtgcagtactacttccactaccaccacgtcaccaagctcgacgaggtg
gctgcctcccagctcaccttccctgccgtcacgctgtgcaacctcaacgagttccgcttt
agccaagtctccaagaatgacctgtaccacgccggggagctgctggccctgctcaacaac
aggtatgagataccagacacgcagatggcagatgaaaagcagctggagatactgcaggac
aaggccaactttcgcagcttcaagcccaagcccttcaacatgcgcgagttttatgaccgc
gcagggcacgacatccgagacatgctgctttcctgccacttccggggggaggtctgcagc
gctgaggacttcaaggtggtcttcacgcggtatggaaagtgctacacgttcaactctggc
cgagacgggcgcccacggctgaagaccatgaagggtgggacgggcaacgggctggagatc
atgctggacattcagcaggacgagtacctgcccgtgtggggggaaaccgatgagacgtcc
ttcgaagcaggcatcaaagtgcagatccacagtcaggatgaacctcccttcatcgaccag
ctgggcttcggcgtagccccagggttccagacctttgtggcctgccaagagcagcggctc
atctacctgcccccgccctggggcacctgcaaagctgttaccatggacttggatttcttc
gactcctacagcattaccgcctgccgcatcgactgtgagacgcgctacctggtggagaac
tgtaactgccgcatggtgcacatgccaggggatgccccatactgcacaccagagcagtac
aaggagtgtgcagatcctgctctggacttcctggtggagaaggaccaggagtactgtgtg
tgtgaaatgccctgcaacctgacccgctatggcaaggagctgtccatggtcaagatcccc
agcaaagcatcagccaaatacttggccaagaagttcaacaagtctgagcagtacataggg
gagaacatcctggtgctggacattttctttgaagtcctgaactatgagaccattgagcag
aagaaggcctatgagattgcagggctcctgggtgacattggaggccaaatggggctgttc
atcggggccagcatcctcacggtgctggaactctttgactacgcctatgaggtcataaaa
cacaagctgtgcagaagagggaagtgccagaaggaggccaaacggagcagcgcggacaag
ggcgtggccctcagcctggatgacgtcaaaagacacaacccgtgcgagagcctccggggc
catcctgccgggatgacgtatgcggccaacatcctacctcaccatccggcccgaggcact
tttgaggactttacctgctga

DBGET integrated database retrieval system