KEGG   Ovis aries (sheep): 101120932Help
Entry
101120932         CDS       T03117                                 

Gene name
GUCY2D
Definition
(RefSeq) retinal guanylyl cyclase 1
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
oas  Ovis aries (sheep)
Pathway
oas00230  Purine metabolism
oas01100  Metabolic pathways
oas04740  Olfactory transduction
oas04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101120932 (GUCY2D)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    101120932 (GUCY2D)
   04740 Olfactory transduction
    101120932 (GUCY2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    101120932 (GUCY2D)
Enzymes [BR:oas01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     101120932 (GUCY2D)
Protein kinases [BR:oas01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   101120932 (GUCY2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA Kinase-like
Motif
Other DBs
NCBI-GeneID: 101120932
NCBI-ProteinID: XP_027831271
Ensembl: ENSOARG00000018476
Position
11
AA seq 1111 aa AA seqDB search
MTVCTLLAGGLRSPGLCAPTRWAPSPPGLPRIPSRPRPQLRPLLLLLLLLLPRSVLSAVF
TVGVLGPWACDPIFASARPDLAARLAASRLNHAAALEGGPRFEVALLPEPCRTPGSLGAV
SSALTRVSGLVGPVNPAACRPAELLAQEAGVALVPWGCPGTRAAGTTAPVVTPAADALYA
LLRAFRWAHVALVTAPQDLWVEAGRALSTALRARGLPVALVTSMEPSDLSGAREALRRVQ
DGPRVRAVIMVMHSVLLGGEEQRCLLEAAEELGLADGSLVFLPFDTLHYALSPGPDALAV
LANNSQLRKAHDAVLTLTRHCPQGGSVRDSLRRAQEHRELPPDLNLQQVSPLFGTIYDSV
FLLAGGLARARAAAGGGWVSGAAVARHIRDARVPGFCGALGGAEEPSFVLLDTDATGDRL
FSTYVLDPTQGFFHSAGTPVHFPKGGRGPGPDPSCWFDPDTICNGGVEPSVVFIGFLLVV
GMGLAGAFLAHYCRHRLLHIQMVSGPNKIILTLDDITFLHPHGGNSRKVAQGSRTSLAAR
STSDIRSIHSQLPDYTNIGLYEGDWVWLKKFPGDRHIAIRPATKMAFSKIRELRHENVAL
YLGLFLAGEAGGPAAPGEGVLAVVSEHCARGSLQDLLAQRDIKLDWMFKSSLLLDLIKGI
RYLHHRGVAHGRLKSRNCVVDGRFVLKVTDHGHGRLLEAQRVLPEPPSAEDQLWTAPELL
RDPVLERRGTLAGDVFSLGIIMQEVVCRSAPYAMLELTPEEVVKRVQSPPPLCRPSVSID
QAPMECIQLMKRCWAEQPELRPSMDRTFELFKSINKGRKMNIIDSMLRMLEQYSSNLEDL
IRERTEELELEKQKTDRLLTQMLPPSVAEALKMGTPVEPEYFEEVTLYFSDIVGFTTISA
MSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPQRNGHRHAAEIANMAL
DILSAVGTFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGL
PYRIHVNKSTVQILSALNEGFLTEVRGRTELKGKGAEETYWLVGRRGFNKPIPKPPDLQP
GASNHGISLHEIPPDRRQKLEKARPGQFSGK
NT seq 3336 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtctgcaccctcctcgcgggtgggcttcggagccccggactctgcgcccccacg
cggtgggctccgtctccgcccggccttccccggatcccgtcccggccccggcctcagctg
aggccactgctgctgctgctgttgctgctcttgccgcgctcagtcctctcggccgtgttc
actgtaggggtgctgggcccctgggcctgcgaccccatcttcgcgagtgcccgcccggac
ctggccgcccgcctggccgcctcccgcctgaaccacgcggctgccctggagggcggcccc
cgcttcgaggtcgcgctgctgcccgagccgtgccggacgccgggctcgctgggggccgtg
tcctcggcgctcacccgcgtctcgggtctcgtggggccggtgaaccccgcagcttgccgg
ccggcggaattactagcccaggaggcgggggtcgctctggtgccctggggctgccccggg
acgcgggcagcgggcaccacggctccggtggtgactcccgcggccgatgccctctacgcc
ctcctgcgagctttccgctgggcgcacgtggccttggtcaccgccccccaggacctgtgg
gtggaggcgggacgcgcactttccacggcgctcagggccaggggcctgcccgtggccctg
gtgacctccatggagccctccgacctgtctggagcgcgagaggctttgaggagggtccaa
gatgggcccagagtcagagcagtgatcatggtaatgcactcggtcttgctgggcggcgag
gagcagcgctgcctgctggaggctgcagaggaactgggcctggccgacggttccctggtc
ttcctgcccttcgacacgctccactacgccttgtctccaggccctgacgccctggcggtg
ctcgccaacaactcacagcttcgcaaggcccacgatgcggtgctcaccctcacccgtcac
tgtccccagggaggcagcgtgcgggacagcctgcgcagggcccaagagcaccgggagctg
cccccggacctcaatctgcagcaggtatcccctctcttcggcaccatctatgactcagtc
ttcttgttggctgggggcctggcgcgagcgcgggcggccgcaggtggcggctgggtctcc
ggagcggcagtggcccgccatatccgggatgcccgggtccctggcttctgtggggccctg
ggcggagctgaggagccctcatttgtgctactggacacggatgccactggggaccggctg
ttctctacatatgttctggaccctacccagggcttcttccactccgctggaaccccagtg
cattttcctaaaggtggacgggggcctgggcctgacccctcgtgttggttcgacccagac
accatctgcaacggaggagtggaacccagcgtcgtctttatcggcttcctcctggtggtt
gggatggggctggctggggccttcctggcccattattgtaggcaccggctgcttcacatt
caaatggtctccggccccaacaagatcatcctgactctggacgacatcaccttcctccac
ccgcatgggggcaactctcgaaaggtggcccaggggagtcgaaccagtctggctgcccgc
agcacatcagatattcgcagcatccacagccagctcccggattacaccaacattggcctc
tatgagggagactgggtttggctgaagaaattcccaggagatcggcacatagctatccgt
ccagcaaccaagatggccttctccaagatccgggaactccggcatgaaaacgtggccctc
tacctggggctcttcctggcgggagaagctggcggccccgcggcccccggggaaggcgtg
ctggctgtggtctcggagcactgtgcccgcggctccctccaagacctcctcgcccagaga
gacataaagctggactggatgttcaagtcctccctccttctggacctcatcaagggaata
aggtatctgcaccatcgaggggtggcccatgggcggctgaagtcacggaactgcgtggtg
gacgggaggttcgtgcttaaagtcaccgaccacggtcatgggcgactgctggaggcacag
agggtgttaccggagccaccgagcgcggaggaccagctatggacagccccggagctgctt
cgagacccggtcctggagcgccgggggacgctggccggcgacgtcttcagtctgggcatc
atcatgcaggaggtcgtgtgccgcagcgccccctacgccatgctggagctcactcccgag
gaagtggtgaagagggtacagagcccccctccactgtgtcggccctccgtgtccatagac
caggcgcccatggagtgcatccagctgatgaaacggtgctgggcagagcagccagaactt
cggccctccatggaccgcacctttgaactgttcaagagcatcaacaagggccggaagatg
aacatcattgactcgatgctgcggatgctggaacagtactccagtaacctggaggacctg
atccgggagcgcacagaggagctggagctggaaaagcagaagacagaccggctgctcaca
cagatgctgcctccgtctgtggcggaggcgctgaagatggggacacctgtggagcccgag
tatttcgaagaggtgacactgtacttcagtgacattgtgggtttcaccaccatctcagcc
atgagtgagcccatcgaagtcgtagacctgctcaatgacctctacacgctcttcgatgcc
atcattggttcccatgatgtctataaggtggagacaattggggacgcctacatggtggcc
tccgggctgccccagaggaatgggcaccggcacgcggcagagatcgccaacatggctctg
gacatcctcagcgccgtgggcaccttccgcatgcgccacatgccggaagtgcctgtgcgc
atccgcattggcctgcactcgggcccgtgcgtggcgggcgtggtgggcctcaccatgccc
cggtactgcctgtttggggacacggtcaacaccgcctcgcgcatggagtccacaggactg
ccttaccgcatccacgtgaacaagagcaccgtgcagatcctctccgccctaaacgagggc
ttcctgactgaggtgcggggccgcacggagctgaagggcaagggcgcagaggaaacgtac
tggctggtgggcagacgcggcttcaacaaacccatccccaaaccaccggacctgcaaccc
ggggcaagcaaccacggcatcagcctgcacgagataccccctgatcggcgccagaagctg
gagaaggcgaggccagggcagttttccgggaagtga

DBGET integrated database retrieval system