KEGG   Ovis aries (sheep): 101121055
Entry
101121055         CDS       T03117                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus protein isoform X2
  KO
K04462  ecotropic virus integration site 1 protein
Organism
oas  Ovis aries (sheep)
Pathway
oas04010  MAPK signaling pathway
oas05200  Pathways in cancer
oas05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101121055 (MECOM)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101121055 (MECOM)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    101121055 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    101121055 (MECOM)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    101121055 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 Zn-ribbon_8 zf-met zf-C2H2_11 PyrI_C
Other DBs
NCBI-GeneID: 101121055
NCBI-ProteinID: XP_004003230
Ensembl: ENSOARG00000000899
Position
1
AA seq 1239 aa
MRSKGRARKLATNNECVYGSYPEIPLEEMPDADGVAGALSLSIQEPCSPATSSEAFTPKE
GSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKIEAGEKFGPYVGEQRSNLKDP
SYGWEILDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIA
PGEELLLFMKSEDYSHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFS
MVEEDFQQKLESENDLREIHAIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAF
NWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATS
SGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSL
NKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGLT
FPTAPGFSFSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPATQD
ILKALSKHPPVGDNKPVELQPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGSD
LESDIESDKEKFKENGKMFKDKVSPLQNLASIHNKKEYSNHSIFSPSLEEQTAVSGAVND
SIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPL
KMEPQSPSEVKKLQKGSSESPFDLTTKRKDEKPLTPVPAKPSATPAASQDQPLDLSMGSR
SRASGTKLTEPRKNHVFGEKKGGNVEPRPASDGSLQHARPTPFFMDPIYRVEKRKLTDPL
EALKEKYLRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPEASELLQSVPSMF
NFRAPPNALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSI
SSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELEST
GAILDDKEDAYFTEIRNFIGNSNHGSQSPRNTEERMNGSHFKDEKALVTNQNSDLLDDEE
VEDEVLLNEEDEDNDITGKMGKEPGTSNLHEGNPEDDYEDTSTLEMSCKASPMRYKEEEY
KTGLSALDHIRHFTDSLKMRKMEDNQYTEAEVSSFSASHVPEELKQPLHRKSKSQAYAMM
LSLSDKESLHSSSHSSSNVWHSMARAAAESSAIQSISHV
NT seq 3720 nt   +upstreamnt  +downstreamnt
atgagatccaaaggcagggcaaggaaactggccacaaataatgagtgtgtatatggcagc
taccctgaaattcctttggaagaaatgccagatgcagatggagtagctggcgctctgtcc
ctcagtattcaagagccatgctctccagccacatccagtgaagcgttcactccgaaggag
ggctctccttacaaagcccccatctacatccccgatgatatccccattcctgctgagttt
gaacttcgagagtcaaatatgcctggagcaggccttggaatatggaccaaaaggaaaatt
gaagcaggtgaaaagtttgggccttatgtgggagagcagaggtcaaacctgaaagaccct
agttatggatgggagatcttagatgagttttgcaatgtgaagttctgcatagatgctagt
caaccagatgtaggaagctggctcaagtacatcaggttcgctggctgttatgatcagcac
aacctcgttgcatgccagataaatgatcagatattttatagagtagtcgcagacattgcc
ccaggagaggagctcctgctgttcatgaagagtgaagactattcccatgaaactatggca
ccagacatccacgaagaacggcagtaccgctgtgaggactgtgaccagctctttgagtcc
aaggccgagctagcagatcaccagaagttcccatgcagcactccccattcggctttctca
atggtagaagaggacttccagcaaaagcttgagagtgaaaatgatctccgagagatacac
gcgattcaggagtgtaaggaatgtgaccaagtgtttcccgacttgcaaagcttggagaaa
cacatgttgtcacatactgaagagagggaatacaagtgcgatcagtgtcccaaggcgttt
aactggaagtccaatttaattcgccaccagatgtcacatgacagtggaaagcactatgaa
tgtgagaactgcgccaaggttttcacggaccctagcaaccttcagcggcacatccgctct
cagcatgttggtgcccgggcccacgcgtgccccgagtgtggcaaaacgtttgccacttcg
tcgggcctcaaacaacacaagcacatccacagcagtgtgaagccctttatctgtgaggtc
tgccataaatcctatactcagttttcaaacctttgtcgtcataagcgcatgcatgctgat
tgcagaacccaaatcaagtgcaaagactgtggacaaatgttcagcactacgtcttcctta
aataaacacaggaggttttgtgagggcaagaaccattttgcggcaggtggattttttggc
caaggcatttcacttcctggaaccccagctatggataaaacgtccatggttaatatgagt
catgccaacccgggccttgctgactattttggcgccaataggcatcctgctggtcttacc
tttccaacagctcctggattttcttttagcttccctggtctatttccttccggcttgtac
cacaggcctcctttgatacctgctagttctcctgttaaaggactgtcaagtactgaacag
acaaacaaaagtcaaagtcccctcatgacacatcctcagatactgccagctacacaggat
attttgaaggcactatctaaacacccacctgtaggggacaataagccagtggagctccag
cccgagaggtcctctgaagagaggccccttgagaaaatcagtgaccagtcagagagtagt
gaccttgatgatgtcagtacgccaagtggcagtgacctggaaacaacctcgggctctgat
ctggaaagtgacattgaaagtgataaagagaaatttaaagaaaatggtaaaatgttcaaa
gacaaagtaagccctcttcagaatctggcttcaatacataataagaaagaatacagcaat
cattccattttctcaccatctttagaggagcagactgcggtgtcaggagctgtgaatgat
tctataaaggctattgcttctattgctgaaaaatactttggttcaacaggactggtgggg
ctgcaagacaaaaaagttggagctttaccttacccttccatgtttcccctcccatttttt
ccagcattctctcaatcaatgtacccatttcctgatagagacttgagatcgttacctttg
aaaatggaaccccaatcaccaagtgaagtaaagaaactgcagaagggaagctctgagtct
ccctttgatctcaccactaaacgcaaggacgagaagcccttaaccccagtacctgccaag
ccttcagcgaccccggctgcaagccaagaccagcccctggatctaagtatgggcagtagg
agtagagccagtgggaccaagctgacggagcctcgtaaaaaccacgtgtttggggagaag
aaaggaggcaacgttgaaccaagaccagcgtcggatggttccttacagcatgctagaccc
actcctttctttatggaccctatttacagagtagagaaaagaaaactaactgacccactt
gaagctttaaaagagaaatacttgaggccttctccaggattcttatttcacccacaattc
caactgcctgatcagagaacttggatgtcagctattgaaaacatggcagagaagctggag
agcttcagtgccctgaaaccagaggccagtgaacttctacagtctgttccctccatgttc
aacttcagagctcctcccaacgccctgccagagaacctcctacggaaaggaaaggaacgc
tatacctgcagatactgtggtaagattttcccaagatctgcgaacctaacacggcacttg
agaacccacacaggagagcagccttatagatgcaagtactgtgacaggtcctttagcata
tcttctaacctgcagcggcatgttcgcaacatccacaataaagagaagccctttaagtgt
cacttatgtgataggtgtttcggtcaacaaaccaacttagacagacacctcaagaagcac
gagaatgggaacatgtctggtacggcaacatcatcgcctcattctgaactggaaagcaca
ggtgcaatcctcgatgacaaggaagacgcttacttcacagaaattcgaaatttcatcggg
aatagcaaccacggcagccagtcccccaggaacactgaagagagaatgaatggcagtcac
tttaaagatgaaaaggctttggtgaccaatcaaaattcagacttactggatgatgaagaa
gtagaagacgaggtgttgttaaatgaggaggatgaagacaatgatattactgggaaaatg
ggaaaggaaccagggacgagtaatttacatgaaggaaaccccgaggatgactatgaagac
accagcaccctggaaatgagctgtaaagcatccccaatgaggtataaagaggaagaatat
aaaactggactttctgctctagatcatataaggcacttcacagatagcctcaaaatgagg
aaaatggaagataatcaatatacagaagctgaggtgtcttctttcagtgcttcccatgtg
ccagaggaacttaaacaaccgttacacagaaagtccaagtcacaggcatacgctatgatg
ttgtcattgtccgacaaggagtccctgcattcttcatcccacagttcttccaacgtgtgg
catagtatggccagggctgcagcggaatccagtgccatccagtccataagccacgtatga

DBGET integrated database retrieval system