KEGG   Ovis aries (sheep): 101121730Help
Entry
101121730         CDS       T03117                                 

Gene name
ZDHHC6
Definition
(RefSeq) palmitoyltransferase ZDHHC6 isoform X1
  KO
K20031  palmitoyltransferase ZDHHC6 [EC:2.3.1.225]
Organism
oas  Ovis aries (sheep)
Brite
KEGG Orthology (KO) [BR:oas00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oas04131]
    101121730 (ZDHHC6)
Enzymes [BR:oas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     101121730 (ZDHHC6)
Membrane trafficking [BR:oas04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    101121730 (ZDHHC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC SH3_2
Motif
Other DBs
NCBI-GeneID: 101121730
NCBI-ProteinID: XP_004020249
Ensembl: ENSOARG00000012114
Position
22
AA seq 413 aa AA seqDB search
MGTFCSVVKFENLQELKRLCHWGPIIALGVIAICSTMAMIDSVLWYWPLHTTGGSVNFIM
LINWTVMILYNYFNAMFVGPGFVPLGWKPKNSQDSVYLQYCKVCQAYKAPRSHHCRKCNR
CVMKMDHHCPWINNCCGYQNHASFTLFLLLAPLGCIHAAFIFVMTMYTQLYNRLSFGWNT
VKIDMSATRRDPLPIIPFGLAAFAATLFALGLALGTTIAVGMLFFIQMKIILRNKTSIES
WIEEKAKDRIQYYQLDDDFVFPYDMGSRWKNFKQVFTWSGVPEGDGLDWPVREDCHQYSL
TIEQLKQKADKRVRSVRYKVIEDYSGTCCPLNRGIKTFFTSPCTEEPRIRLQKGEFILAT
RGLRYWLYGDKILDDSVLEGVSRIRGWFPRNCVEKCPCDTETDQAPEGEKKNR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgggtacattctgctcagttgtcaagtttgaaaatctccaagaattaaagagactttgt
cactggggtcccattatagcccttggtgttatagcaatatgttctaccatggccatgatt
gactctgtgttgtggtattggcccttacataccactggaggaagcgtgaatttcattatg
ttgataaactggactgtcatgattctttataattacttcaatgccatgtttgttggtcct
ggcttcgtccctctggggtggaaaccgaaaaattctcaggatagcgtgtacctccagtat
tgtaaagtctgccaagcatacaaggcaccacggtcacatcactgcagaaagtgtaacaga
tgtgtgatgaagatggaccatcactgcccttggatcaacaactgctgcggctatcagaat
cacgcttccttcacgctgttcctccttttagcaccactgggctgtattcacgctgccttt
atttttgtcatgacaatgtatacgcagctttataatcggctctcctttgggtggaacacc
gtcaagattgatatgagtgcaacccggagagaccctcttccgattattccttttggatta
gctgcgtttgctgccaccttgtttgccttgggattagctttaggaacaaccatagctgtt
gggatgttgttttttatccagatgaaaataattctcagaaacaaaacttctattgaatca
tggattgaagagaaggctaaagatcgaattcaatattatcaactagatgacgactttgtt
tttccttatgatatgggaagtagatggaagaacttcaaacaagtattcacatggtcaggg
gtccctgaaggagatgggctggattggccagttagagaagactgtcaccagtacagctta
acaatagaacagctgaaacaaaaagcagataaaagagtcagaagtgtccggtataaagtg
atagaagattatagtggtacctgctgtcctttgaatagaggaatcaaaacattcttcaca
agcccctgcactgaagaacctcggataaggctacagaaaggggaattcatcttagctaca
agagggttacgatactggttgtatggagacaaaattcttgatgattctgttttagaaggt
gtttcaagaataagaggatggttccctagaaactgtgtagaaaagtgcccctgtgacacc
gaaacagatcaagccccagagggcgagaagaaaaacagatag

DBGET integrated database retrieval system