KEGG   Ovis aries (sheep): 101121783Help
Entry
101121783         CDS       T03117                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: selenide, water dikinase 2-like
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
oas  Ovis aries (sheep)
Pathway
oas00450  Selenocompound metabolism
oas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    101121783
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:oas03016]
    101121783
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     101121783
Transfer RNA biogenesis [BR:oas03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    101121783
 Prokaryotic Type
    101121783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-GeneID: 101121783
NCBI-ProteinID: XP_027817931
Position
25
AA seq 508 aa AA seqDB search
MAEVAATGASGEAMAAVAVGEGSSGPVGLPLGRGFSSYWPFEPQALGLSPSWRLTGFSGM
KGUGCKVPQEMLLKLLEGLTRPEVLPMSGRRLVGGLEEMAQEAGLPVRVEPSPPFPSLGI
GMDSCVIPLRHGGLSLVQTTDFFYPLVEDPYMMGRITCANVLSDLYAMGITECDNMLLLL
SVSQSMPEEEREKITPLMIKGFQDAAEEGGTAVTGGQMVVNPWIIIGGVATVVCQPNEFI
LPDSAVVGDVLMLTKPSGTQVAVNAHQWLDNPEQWNKIKMVVSRKEVELGYQEAMFNMAT
LNRIAAGXMHTFNAHAATDITGFGILGHSQNLAKQQRNEVSFVIHNLPIIAKMAAISKAS
GRFGLLQGISAETSGGLLICLPREQAARFCSEIKSSKYGEGHQAWIVGIVEKGDRIAQII
DKPRVIEVLPRGATTTLAPENSSASSELSLWDGTAEVVRTVSICTGSASPASIPALSHNC
PFKLQTPSSMLQQGGLGHLEHGSCHCCE
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagtcgcagcgactggtgccagcggagaggctatggcggcagtggcggtgggg
gaaggctcctcgggcccggtgggcttgcctctaggccggggcttctcgagctactggccc
ttcgagccccaggcgttgggtctcagcccgagctggcggctcaccggcttctctggcatg
aagggctgaggctgcaaggtcccccaggagatgctgctcaaactcctggagggactgacg
agaccggaggtgctgcccatgtcgggccggcgcttggtcggaggccttgaagagatggcc
caggaagccggtctgccggtgagggtggaacccagccctcccttccccagcctgggcatt
gggatggactcctgcgtcatacccctgagacacgggggcctgtccttggtgcagaccacc
gacttcttttaccccctggtggaagatccctatatgatggggcgcatcacatgtgccaac
gtgctgagtgacctctacgcgatgggcattactgagtgtgacaacatgttgctgctactc
agcgtcagccagagtatgcctgaggaggagcgagaaaagataacaccactcatgatcaaa
ggttttcaggatgctgccgaggaaggagggactgcagtgactggtgggcaaatggtggta
aacccttggattatcatcggtggagttgccactgtagtatgtcaaccaaatgaattcatc
ttgcctgacagcgccgttgttggggatgtgctcatgttaactaaaccctcaggaacccag
gttgccgtcaatgcccaccaatggctggataatcctgaacaatggaataagataaagatg
gtggtctccagaaaagaggtagagctgggttatcaggaagccatgttcaacatggctacc
ctcaatagaattgctgctggcntgatgcacacgtttaatgcccacgcagccacagatatc
accggctttggcattctgggccactctcagaaccttgcaaaacaacaaagaaatgaggtc
tcctttgtcattcataatctgcccatcattgccaagatggctgccatcagcaaggccagc
gggcgctttggtctcctgcaaggaatctcagcagaaacttctggggggctactgatttgt
ctgccaagagaacaagcagctcgcttttgttcagaaatcaaatcttcaaagtatggagag
ggtcatcaagcctggatcgtcggtattgtggaaaagggagaccggatagcccagatcatt
gacaagcctcgcgtcattgaggtcctacctcgtggggccactactactcttgctcctgag
aattccagtgcctcctctgagcttagcttgtgggatggaacagcagaagttgttcgaact
gtttccatctgtactggtagtgcctcccctgcatccattcctgctttgagccacaactgc
ccctttaagctacagaccccatcctccatgctgcagcagggcgggctgggtcacctggaa
cacgggtcctgccactgctgtgagtga

DBGET integrated database retrieval system