KEGG   Ovis aries (sheep): 101123008
Entry
101123008         CDS       T03117                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas01524  Platinum drug resistance
oas04010  MAPK signaling pathway
oas04012  ErbB signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04022  cGMP-PKG signaling pathway
oas04024  cAMP signaling pathway
oas04062  Chemokine signaling pathway
oas04066  HIF-1 signaling pathway
oas04068  FoxO signaling pathway
oas04071  Sphingolipid signaling pathway
oas04072  Phospholipase D signaling pathway
oas04114  Oocyte meiosis
oas04140  Autophagy - animal
oas04148  Efferocytosis
oas04150  mTOR signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04210  Apoptosis
oas04218  Cellular senescence
oas04261  Adrenergic signaling in cardiomyocytes
oas04270  Vascular smooth muscle contraction
oas04350  TGF-beta signaling pathway
oas04360  Axon guidance
oas04370  VEGF signaling pathway
oas04371  Apelin signaling pathway
oas04380  Osteoclast differentiation
oas04510  Focal adhesion
oas04520  Adherens junction
oas04540  Gap junction
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04611  Platelet activation
oas04613  Neutrophil extracellular trap formation
oas04620  Toll-like receptor signaling pathway
oas04621  NOD-like receptor signaling pathway
oas04625  C-type lectin receptor signaling pathway
oas04650  Natural killer cell mediated cytotoxicity
oas04657  IL-17 signaling pathway
oas04658  Th1 and Th2 cell differentiation
oas04659  Th17 cell differentiation
oas04660  T cell receptor signaling pathway
oas04662  B cell receptor signaling pathway
oas04664  Fc epsilon RI signaling pathway
oas04666  Fc gamma R-mediated phagocytosis
oas04668  TNF signaling pathway
oas04713  Circadian entrainment
oas04720  Long-term potentiation
oas04722  Neurotrophin signaling pathway
oas04723  Retrograde endocannabinoid signaling
oas04724  Glutamatergic synapse
oas04725  Cholinergic synapse
oas04726  Serotonergic synapse
oas04730  Long-term depression
oas04810  Regulation of actin cytoskeleton
oas04910  Insulin signaling pathway
oas04912  GnRH signaling pathway
oas04914  Progesterone-mediated oocyte maturation
oas04915  Estrogen signaling pathway
oas04916  Melanogenesis
oas04917  Prolactin signaling pathway
oas04919  Thyroid hormone signaling pathway
oas04921  Oxytocin signaling pathway
oas04926  Relaxin signaling pathway
oas04928  Parathyroid hormone synthesis, secretion and action
oas04929  GnRH secretion
oas04930  Type II diabetes mellitus
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas04934  Cushing syndrome
oas04935  Growth hormone synthesis, secretion and action
oas04960  Aldosterone-regulated sodium reabsorption
oas05010  Alzheimer disease
oas05020  Prion disease
oas05022  Pathways of neurodegeneration - multiple diseases
oas05034  Alcoholism
oas05132  Salmonella infection
oas05133  Pertussis
oas05135  Yersinia infection
oas05140  Leishmaniasis
oas05142  Chagas disease
oas05145  Toxoplasmosis
oas05152  Tuberculosis
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05164  Influenza A
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05170  Human immunodeficiency virus 1 infection
oas05171  Coronavirus disease - COVID-19
oas05200  Pathways in cancer
oas05203  Viral carcinogenesis
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05207  Chemical carcinogenesis - receptor activation
oas05208  Chemical carcinogenesis - reactive oxygen species
oas05210  Colorectal cancer
oas05211  Renal cell carcinoma
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05216  Thyroid cancer
oas05218  Melanoma
oas05219  Bladder cancer
oas05220  Chronic myeloid leukemia
oas05221  Acute myeloid leukemia
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05230  Central carbon metabolism in cancer
oas05231  Choline metabolism in cancer
oas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oas05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101123008 (MAPK3)
   04012 ErbB signaling pathway
    101123008 (MAPK3)
   04014 Ras signaling pathway
    101123008 (MAPK3)
   04015 Rap1 signaling pathway
    101123008 (MAPK3)
   04350 TGF-beta signaling pathway
    101123008 (MAPK3)
   04370 VEGF signaling pathway
    101123008 (MAPK3)
   04371 Apelin signaling pathway
    101123008 (MAPK3)
   04668 TNF signaling pathway
    101123008 (MAPK3)
   04066 HIF-1 signaling pathway
    101123008 (MAPK3)
   04068 FoxO signaling pathway
    101123008 (MAPK3)
   04072 Phospholipase D signaling pathway
    101123008 (MAPK3)
   04071 Sphingolipid signaling pathway
    101123008 (MAPK3)
   04024 cAMP signaling pathway
    101123008 (MAPK3)
   04022 cGMP-PKG signaling pathway
    101123008 (MAPK3)
   04151 PI3K-Akt signaling pathway
    101123008 (MAPK3)
   04150 mTOR signaling pathway
    101123008 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101123008 (MAPK3)
   04148 Efferocytosis
    101123008 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101123008 (MAPK3)
   04210 Apoptosis
    101123008 (MAPK3)
   04218 Cellular senescence
    101123008 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101123008 (MAPK3)
   04520 Adherens junction
    101123008 (MAPK3)
   04540 Gap junction
    101123008 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101123008 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101123008 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101123008 (MAPK3)
   04613 Neutrophil extracellular trap formation
    101123008 (MAPK3)
   04620 Toll-like receptor signaling pathway
    101123008 (MAPK3)
   04621 NOD-like receptor signaling pathway
    101123008 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    101123008 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    101123008 (MAPK3)
   04660 T cell receptor signaling pathway
    101123008 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    101123008 (MAPK3)
   04659 Th17 cell differentiation
    101123008 (MAPK3)
   04657 IL-17 signaling pathway
    101123008 (MAPK3)
   04662 B cell receptor signaling pathway
    101123008 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    101123008 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    101123008 (MAPK3)
   04062 Chemokine signaling pathway
    101123008 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101123008 (MAPK3)
   04929 GnRH secretion
    101123008 (MAPK3)
   04912 GnRH signaling pathway
    101123008 (MAPK3)
   04915 Estrogen signaling pathway
    101123008 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    101123008 (MAPK3)
   04917 Prolactin signaling pathway
    101123008 (MAPK3)
   04921 Oxytocin signaling pathway
    101123008 (MAPK3)
   04926 Relaxin signaling pathway
    101123008 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    101123008 (MAPK3)
   04919 Thyroid hormone signaling pathway
    101123008 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    101123008 (MAPK3)
   04916 Melanogenesis
    101123008 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101123008 (MAPK3)
   04270 Vascular smooth muscle contraction
    101123008 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101123008 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101123008 (MAPK3)
   04725 Cholinergic synapse
    101123008 (MAPK3)
   04726 Serotonergic synapse
    101123008 (MAPK3)
   04720 Long-term potentiation
    101123008 (MAPK3)
   04730 Long-term depression
    101123008 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    101123008 (MAPK3)
   04722 Neurotrophin signaling pathway
    101123008 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    101123008 (MAPK3)
   04380 Osteoclast differentiation
    101123008 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101123008 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101123008 (MAPK3)
   05206 MicroRNAs in cancer
    101123008 (MAPK3)
   05205 Proteoglycans in cancer
    101123008 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    101123008 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    101123008 (MAPK3)
   05203 Viral carcinogenesis
    101123008 (MAPK3)
   05230 Central carbon metabolism in cancer
    101123008 (MAPK3)
   05231 Choline metabolism in cancer
    101123008 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101123008 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101123008 (MAPK3)
   05212 Pancreatic cancer
    101123008 (MAPK3)
   05225 Hepatocellular carcinoma
    101123008 (MAPK3)
   05226 Gastric cancer
    101123008 (MAPK3)
   05214 Glioma
    101123008 (MAPK3)
   05216 Thyroid cancer
    101123008 (MAPK3)
   05221 Acute myeloid leukemia
    101123008 (MAPK3)
   05220 Chronic myeloid leukemia
    101123008 (MAPK3)
   05218 Melanoma
    101123008 (MAPK3)
   05211 Renal cell carcinoma
    101123008 (MAPK3)
   05219 Bladder cancer
    101123008 (MAPK3)
   05215 Prostate cancer
    101123008 (MAPK3)
   05213 Endometrial cancer
    101123008 (MAPK3)
   05224 Breast cancer
    101123008 (MAPK3)
   05223 Non-small cell lung cancer
    101123008 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101123008 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    101123008 (MAPK3)
   05161 Hepatitis B
    101123008 (MAPK3)
   05160 Hepatitis C
    101123008 (MAPK3)
   05171 Coronavirus disease - COVID-19
    101123008 (MAPK3)
   05164 Influenza A
    101123008 (MAPK3)
   05163 Human cytomegalovirus infection
    101123008 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101123008 (MAPK3)
   05165 Human papillomavirus infection
    101123008 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101123008 (MAPK3)
   05135 Yersinia infection
    101123008 (MAPK3)
   05133 Pertussis
    101123008 (MAPK3)
   05152 Tuberculosis
    101123008 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101123008 (MAPK3)
   05140 Leishmaniasis
    101123008 (MAPK3)
   05142 Chagas disease
    101123008 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101123008 (MAPK3)
   05020 Prion disease
    101123008 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    101123008 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    101123008 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101123008 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101123008 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101123008 (MAPK3)
   04934 Cushing syndrome
    101123008 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101123008 (MAPK3)
   01524 Platinum drug resistance
    101123008 (MAPK3)
   01522 Endocrine resistance
    101123008 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    101123008 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    101123008 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oas04147]
    101123008 (MAPK3)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101123008 (MAPK3)
Protein kinases [BR:oas01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101123008 (MAPK3)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101123008 (MAPK3)
Exosome [BR:oas04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101123008 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Choline_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 101123008
NCBI-ProteinID: XP_014959644
EnsemblRapid: ENSOARG00020015005
Position
24:26693224..26700008
AA seq 380 aa
MAAAAAAQGGGGGEPRGTDGVGPGVPGEVEIVKGQPFDVGPRYTQLQYIGEGAYGMVSSA
YDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVY
IVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS
DPKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER
LKELIFQETARFQPGVLEAS
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggctcaggggggcgggggcggggagccccggggaactgatggg
gtcggcccgggggtcccgggggaggtggagatagtaaaggggcagccgttcgacgtgggc
ccgcgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcagct
tacgaccacgtgcgcaagactcgagtggccatcaagaagatcagcccctttgagcatcag
acctactgccagcgcacgttgcgagagattcagattctgctgcgcttccgccatgagaat
gtcattggcatccgagacattctgcgagcacccaccctggaagccatgagggatgtctac
atcgtgcaggatctgatggagacagacctgtacaaattgctcaaaagccagcagctgagc
aacgaccatgtatgctacttcctgtaccagatcctgcggggcctgaagtatatccactcc
gccaacgtgctccaccgggatttaaagccctccaacctgctcatcaacaccacctgcgac
cttaagatctgtgatttcggtcttgcccggattgctgatcccgagcatgaccacactggc
ttcttgacggaatacgtggccacacgctggtaccgggccccagagatcatgcttaactcc
aagggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctc
tccaaccggcccatcttccccggcaagcactacctggaccagctcaaccacattctgggt
attctgggctccccatcccaggaggacctgaactgtatcatcaacatgaaagcccgaaac
tacctgcagtctctgccctccaagaccaaggtggcctgggccaagctttttcctaagtca
gaccccaaagctcttgacctgctggaccggatgttgacctttaaccccaacaaacggatc
acagtggaagaagcgctggctcacccctacctggagcagtactatgacccaacggatgag
ccagtggccgaggaacctttcaccttcgacatggagctggatgatctacccaaggaacga
ctgaaggagctcatcttccaggagacagcccgcttccagcctggggtgctggaggcctcc
taa

DBGET integrated database retrieval system