KEGG   Ovis aries (sheep): 101123378
Entry
101123378         CDS       T03117                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase isoform X2
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
oas  Ovis aries (sheep)
Pathway
oas00230  Purine metabolism
oas00240  Pyrimidine metabolism
oas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101123378 (DCK)
   00240 Pyrimidine metabolism
    101123378 (DCK)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     101123378 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_28 AAA_33 CoaE DUF932
Other DBs
NCBI-GeneID: 101123378
NCBI-ProteinID: XP_004009944
Ensembl: ENSOARG00000012101
UniProt: A0A6P3EAG5 W5PR96
Position
6
AA seq 260 aa
MATPPKRSCPSPAASSEGTRIKKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPVARWCN
VQSTQNEFEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLAALNGKLKDAE
KPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNE
DFKDKHDSLIEKVKDFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaccccacccaagaggagctgcccgtctcccgcagccagctctgaggggacccgc
atcaagaaaatttccatcgaagggaacatcgctgctgggaagtcaacgtttgtgaatatt
ctgaaacaagtctgtgaggactgggaagtggtgcctgaacctgttgccaggtggtgcaat
gttcagagtactcagaatgaatttgaggaactgacaacatctcagaaaagtggcgggaat
gttcttcagatgatgtatgagaaacctgaacgatggtcttttaccttccagtcatatgcc
tgcctcagtcgaatacgagctcagcttgctgctctcaatggaaaactcaaagatgcagag
aaaccagtattattttttgaacgatctgtgtatagtgacaggtatatttttgcatctaat
ttgtatgaatctgactgcatgaatgaaacagagtggaccatttatcaagactggcatgac
tggatgaataaccagtttggccaaagccttgaactagatggaatcatttatcttagagcc
actcctgagaaatgcttgaatagaatatatttacggggaagaaacgaagaacaaggcatt
cctcttgaatacttggagaaacttcactataagcatgaaagctggctcctgcatagaaca
ctaaaaaccaactttgattatctacaagaagtgcctatcttaacactggatgttaatgaa
gactttaaagacaaacatgacagtctaattgaaaaggtaaaagactttttgagcactttg
tga

DBGET integrated database retrieval system