KEGG   Ovis aries (sheep): 101123537Help
Entry
101123537         CDS       T03117                                 

Definition
(RefSeq) intestinal-type alkaline phosphatase-like
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas00730  Thiamine metabolism
oas00790  Folate biosynthesis
oas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    101123537
   00790 Folate biosynthesis
    101123537
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oas04147]
    101123537
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:oas00537]
    101123537
Enzymes [BR:oas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     101123537
Exosome [BR:oas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101123537
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:oas00537]
 Enzymes
  101123537
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 101123537
NCBI-ProteinID: XP_014948331
Position
2
AA seq 531 aa AA seqDB search
MQGACVLLLLGLRLQLSLSLVPVEEEDPAFWNRQAAQALDVAKKLQPIQTAAKNVILFLG
DGMGVSTVTATRILKGQMAGKPGPETPLAMDKFPYMALSKTYNVDRDVPDSAGTTTAYLC
GVKTRMKVIGVSAAAQFNQCNTTYGNEVTSVINRAKKAGKSVGVVTTTTVQHASPAGAYA
HTVNRNWYSDAQMPAQAKREGCQDIATQLVYNMDIDVILGGGRIYMFPEGTPDPEYPYNI
RQNGVRKDKRNLVQEWQAKHQGAQYVWNRTALLQAANDSSVTKLMGLFEPGDMAYDIHRD
HIKDPSLEEMTEAAVRVLSRNPQGFFLFVEGGRIDHGHHESIAYRALTEAVMFDNAIAKA
SQLTSEADTLTLVTADHSHVFTFGGYPLRGTSIFGLADGKAGDGKSYTSLLYGNGPGYRL
YMGSRSDVNEKQSMDPEYQQQSAVPLGGETHAGEDVAVFARGPWAHLMHGVQEQTFVAHV
MAFAACVEPYTTDCNPQPPSGPSDAAHQAACPSSLALLAGALLLLLVPTLH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgcagggggcctgtgtgctgctgctgctgggcctgcggctacagctctccctcagcctc
gtcccagtcgaggaggaggaccccgccttctggaaccgccaggctgcccaggccctcgat
gtggctaagaagctgcagcccatccagacagccgccaagaatgtcatcctcttcttgggc
gatgggatgggcgtttccacggtgacagccactcggatcctaaaggggcagatggctggc
aagccgggacctgagacacccctggccatggacaagttcccctacatggctctgtccaag
acatacaacgtggacagagatgtgcctgacagcgcaggcacaaccaccgcctacctgtgt
ggggtcaagacccgtatgaaggtcatcggtgtaagtgcagctgcccaattcaaccagtgc
aacacgacatatgggaacgaggtcacgtctgtgataaaccgggccaagaaagcaggcaag
tcagtgggagtggtgaccaccaccacagtgcagcacgcctccccagccggggcctacgcg
cacacggtgaaccgaaactggtattctgacgctcagatgcctgcccaggccaagagggag
ggctgccaggacatcgccacacagctggtctacaacatggatattgatgtgatcctgggt
ggaggccgaatatacatgtttcctgaggggaccccagaccctgaatatccatacaatata
agacagaatggagtccggaaggacaagcggaacctggtacaggagtggcaggccaagcac
cagggagcccagtatgtgtggaaccgcacagcgctccttcaggcggccaatgactccagt
gtaacaaaactcatgggcctctttgagccaggagacatggcctatgacatccaccgagac
cacatcaaggacccatccctggaggagatgacagaggcagccgtgcgtgtgctgagcaga
aaccctcagggcttcttcctcttcgtggagggaggccgcattgaccacggtcaccatgaa
agcatagcttatcgggcgctcactgaggcggttatgttcgacaacgccatcgccaaggct
agccagctcaccagtgaagcagacacactgaccctcgtcaccgccgaccactcccatgtc
ttcactttcggtggctacccacttcgtgggacctccatctttgggctggctgatggcaag
gccggagatggcaagtcctatacctccctcctctatggcaacggcccagggtatcggctg
tacatgggctcacgatctgatgtgaatgaaaagcagagcatggaccccgagtaccagcag
caatccgcagtgcccctagggggcgaaacccacgctggtgaggacgtggcagtgtttgca
cgaggcccgtgggcacacctgatgcacggcgtgcaggagcagaccttcgtggcgcatgtc
atggcctttgctgcctgcgtggagccctacaccaccgactgcaaccctcagccccccagc
ggtccctcggacgctgcccaccaggcggcctgcccatcctcactggcactgctggccggg
gccctactgctgctgctggtgcccaccctgcactga

DBGET integrated database retrieval system