KEGG   Ovis aries (sheep): 114116817Help
Entry
114116817         CDS       T03117                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: sphingosine kinase 1-like
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
oas  Ovis aries (sheep)
Pathway
oas00600  Sphingolipid metabolism
oas01100  Metabolic pathways
oas04020  Calcium signaling pathway
oas04071  Sphingolipid signaling pathway
oas04072  Phospholipase D signaling pathway
oas04370  VEGF signaling pathway
oas04371  Apelin signaling pathway
oas04666  Fc gamma R-mediated phagocytosis
oas05152  Tuberculosis
Module
oas_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    114116817
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    114116817
   04371 Apelin signaling pathway
    114116817
   04020 Calcium signaling pathway
    114116817
   04072 Phospholipase D signaling pathway
    114116817
   04071 Sphingolipid signaling pathway
    114116817
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    114116817
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    114116817
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     114116817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 114116817
NCBI-ProteinID: XP_027829845
Position
11
AA seq 392 aa AA seqDB search
MLTAGGSRNPLPRPCHVLVLLNXRGGKGKALQLFWSHVQPLLAQADVSFTLMLTERRNHA
RELVRAEDLRRWDALVVMSGDGLIHEVVNGLMERPDWETAIQKPLCSLPAGSGNAVAASL
NYYAGYEQVTKEDLLTNCTQLLCRRLLAPMDLLSLQTACGQRLFSVLSLAWGFIADVDLE
SEKFRRLGEIRFTLGTCLRLVALRTYRGTLAYLPAETLASRRXPSPAWAPQAPADTHVVP
LEQPVPPHWTVVPEQDFVLVLALLHSHLASELFTAPMGRCSAGTMHLFYVRAGVSRATLL
RLFLAMEKGRHMECHCPHLVYVPVVAFRLEPKDGKGVFAVDGELLISEAVQGQVLPNYFW
MVSGYRESPPSLKPQPSPRRKSQQRPPPAERR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcttacagcgggaggctcccggaatccgctcccaaggccctgccacgtgctggtgctg
ttaaatncgcgcgggggcaagggcaaagccctgcagctcttctggagccacgtgcagccg
ctgctggcccaggccgacgtctccttcacgctgatgctcactgagcggcggaaccacgcc
cgggagctggtgcgcgccgaggacctgagacgctgggacgcgctggtggtcatgtccggg
gacgggctgatccatgaggtggtgaacgggctcatggagcggcctgactgggagaccgcc
atccagaagcccctgtgtagcctcccggccggctctggcaatgcggtggccgcttctttg
aactattacgccgggtatgagcaggtgactaaggaagacctcctgaccaactgcacgcag
ctgctgtgccgccggctgctggcacccatggacctgctatccctgcagaccgcctgcggg
cagcgcctcttctccgtgctcagcctggcatggggtttcatcgccgatgtggatctggag
agcgagaagtttcggcgcctgggcgagatccgcttcactctaggcacctgcctgcgcctg
gtggccctgcgcacctaccggggcaccctggcctacctgcccgcagaaacgctggcctcc
aggaggnggccctccccggcttgggccccgcaggcccccgcggacacccacgtggtgccc
ctggagcagccagtgcctcctcactggacggtggtgccggagcaggacttcgtgctggtg
ttggcactcctgcactcccacctggccagtgagcttttcaccgcccccatgggccgctgt
tcagccggcaccatgcatctgttctacgtgcgcgccggcgtgtcccgggccacgctgctg
cgcctcttcctggccatggagaaaggcaggcacatggagtgccactgcccccacctggtg
tatgtgcccgtggttgccttccgcctggagcccaaggatgggaagggtgtgtttgctgtg
gatggggaactgctgatcagtgaggctgtccagggccaggttctccccaactacttctgg
atggtcagtggctacagggagtccccaccctctctgaaaccgcagccctcaccccgcagg
aagtctcagcagaggccgcccccagcagagcgccggtga

DBGET integrated database retrieval system