KEGG   Ovis aries (sheep): 443138Help
Entry
443138            CDS       T03117                                 

Gene name
OXTR
Definition
(RefSeq) oxytocin receptor
  KO
K04229  oxytocin receptor
Organism
oas  Ovis aries (sheep)
Pathway
oas04020  Calcium signaling pathway
oas04024  cAMP signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    443138 (OXTR)
   04024 cAMP signaling pathway
    443138 (OXTR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    443138 (OXTR)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    443138 (OXTR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:oas04030]
    443138 (OXTR)
G protein-coupled receptors [BR:oas04030]
 Rhodopsin family
  Peptide
   Oxytocin
    443138 (OXTR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx 7TM_GPCR_Srx Gaa1
Motif
Other DBs
NCBI-GeneID: 443138
NCBI-ProteinID: NP_001009752
UniProt: Q9BDP3
Position
19
AA seq 391 aa AA seqDB search
MEGAFAANWSAEAVNGSAAPPGTEGNRTAGPPQRNEALARVEVAVLSLILFLALSGNACV
LLALRTTRHKHSRLFFFMKHLSIADLAVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREV
ADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTEAAAA
EAAAGAEGAAADCAGRAALARVSNVKLISKAKIRTVKMTFIVVLAFIVCWTPFFFVQMWS
VWDADAPKEASAFIIAMLLASLNSCCNPWIYTLFTGHLFQDLVQRFLCCSFRRLKGSQPG
ETSVSKKTHSYTFVLSRHSSSQRSCSQPSTV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggagggcgcgtttgcggcaaactggagcgcggaggcggtcaacgggagcgcggcgcct
ccgggaaccgagggcaatcgcactgccgggccgccacagcgcaacgaggccctggcgcgg
gtggaggtggccgtgctgtccctcatcctgttcctggcgctgagcggcaacgcgtgcgtg
ctgctggcgctgcgcaccacgcgccacaagcactcgcgcctcttcttcttcatgaagcac
ctgagcatagccgacctggcggtggcggtgttccaggtgctgccgcagcttctgtgggac
atcacgttccgtttctacgggcccgacctgctctgccgcctcgtcaagtacctgcaggtg
gtgggcatgttcgcgtccacctacctgctgctgctcatgtcgctcgaccgctgcctggcc
atctgccagccgctgcgctcgctgcgccgccgcaccgaccgcctggcggtactcgccacc
tggctcggctgcctggtggccagcgcgccgcaggtgcacatcttctcgctgcgcgaggtg
gccgacggcgtcttcgactgctgggccgttttcattcagccctgggggcccaaggcctac
atcacgtggatcacgctcgccgtctacattgtgccggtcatcgtgcttgccgcctgctac
ggccttatcagcttcaagatctggcagaacttacggctcaagacggaggcggcggcggca
gaggctgccgcgggggctgagggcgcggcggcagactgcgcggggcgcgcggctctggcc
cgcgtcagcaacgtcaagctcatctctaaggctaagatccgcacggtcaagatgaccttc
atcgtcgtgctggccttcatcgtgtgctggacgccattctttttcgtgcagatgtggagt
gtctgggatgccgatgcgcccaaggaagcctcggctttcatcatcgccatgcttctggcc
agcctcaacagctgctgcaacccctggatctacacgctcttcacgggccacctcttccaa
gaccttgtgcagcgcttcctctgctgctcattccgccgcctgaaaggcagccagcctggg
gagacgagcgtcagcaaaaagacccattcgtacacctttgtcctgagtcggcacagctcc
agccagagaagctgctcgcagccatccacggtgtga

DBGET integrated database retrieval system