KEGG   Ovis aries (sheep): 443141
Entry
443141            CDS       T03117                                 

Gene name
ITGB1
Definition
(RefSeq) integrin beta-1 precursor
  KO
K05719  integrin beta 1
Organism
oas  Ovis aries (sheep)
Pathway
oas04015  Rap1 signaling pathway
oas04145  Phagosome
oas04151  PI3K-Akt signaling pathway
oas04360  Axon guidance
oas04510  Focal adhesion
oas04512  ECM-receptor interaction
oas04514  Cell adhesion molecules
oas04530  Tight junction
oas04611  Platelet activation
oas04670  Leukocyte transendothelial migration
oas04810  Regulation of actin cytoskeleton
oas05100  Bacterial invasion of epithelial cells
oas05133  Pertussis
oas05135  Yersinia infection
oas05140  Leishmaniasis
oas05145  Toxoplasmosis
oas05165  Human papillomavirus infection
oas05200  Pathways in cancer
oas05205  Proteoglycans in cancer
oas05222  Small cell lung cancer
oas05410  Hypertrophic cardiomyopathy
oas05412  Arrhythmogenic right ventricular cardiomyopathy
oas05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    443141 (ITGB1)
   04151 PI3K-Akt signaling pathway
    443141 (ITGB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    443141 (ITGB1)
   04514 Cell adhesion molecules
    443141 (ITGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    443141 (ITGB1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    443141 (ITGB1)
   04530 Tight junction
    443141 (ITGB1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    443141 (ITGB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    443141 (ITGB1)
   04670 Leukocyte transendothelial migration
    443141 (ITGB1)
  09158 Development and regeneration
   04360 Axon guidance
    443141 (ITGB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    443141 (ITGB1)
   05205 Proteoglycans in cancer
    443141 (ITGB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    443141 (ITGB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    443141 (ITGB1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    443141 (ITGB1)
   05133 Pertussis
    443141 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    443141 (ITGB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    443141 (ITGB1)
   05140 Leishmaniasis
    443141 (ITGB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    443141 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    443141 (ITGB1)
   05414 Dilated cardiomyopathy
    443141 (ITGB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oas04131]
    443141 (ITGB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oas04147]
    443141 (ITGB1)
   04515 Cell adhesion molecules [BR:oas04515]
    443141 (ITGB1)
   04090 CD molecules [BR:oas04090]
    443141 (ITGB1)
Membrane trafficking [BR:oas04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    443141 (ITGB1)
Exosome [BR:oas04147]
 Exosomal proteins
  Proteins found in most exosomes
   443141 (ITGB1)
Cell adhesion molecules [BR:oas04515]
 Integrins
  Integrin beta subunits
   443141 (ITGB1)
CD molecules [BR:oas04090]
 Proteins
  443141 (ITGB1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 443141
NCBI-ProteinID: NP_001107242
Ensembl: ENSOARG00000017638
UniProt: B0FYY4
Position
13
AA seq 798 aa
MNLQLIFWIGLISSVCCVFGQADENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCHPNDIENPRGSKDIKKNKNVTNRSKGTAEKLQPEDITQIQPQQLV
LQLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTNEQNCTSPFSYKNVLSLTDKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENDMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSGNVIQLIIDAYNSLSSEVILENSKLPEGVTINYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITANKCPNKNSETIKIKPLGFTEEVEIILQFICECECQSEGIPGSPKCHDG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTTSCM
AVNGQICNGRGVCECGACKCTDPKFQGPTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CAQECSHFNITKVENRDKLPQPGQVDPLSHCKEKDVDDCWFYFTYSVNGNNEATVHVVET
PECPTGPDIIPIVAGVVAGIVLIGPALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgaatttacaactgattttctggatcggattgatcagttcagtttgctgtgtgtttggc
caagcagatgaaaatagatgtttgaaagcaaatgccaagtcatgtggggagtgtatacaa
gcagggccaaattgtggatggtgcacaaattcaacatttttacaagaaggtatgcctaca
tctgctcgatgtgatgatttagaagccttaaaaaagaagggctgtcatccaaatgacatt
gaaaatcccagaggctccaaagatataaagaaaaataaaaatgtaacgaaccgaagcaaa
ggaacagcagagaagctgcagccagaagatatcactcaaatccagccacagcagttggtt
ctgcagttacgatcaggggagccacagacattcacactaaaattcaagcgggctgaagac
tatcccatcgatctctactacctcatggacctctcctattccatgaaagacgacttagag
aatgtgaaaagtctggggacagatttgatgaatgaaatgaggaggatcacttcagacttc
cgaatcgggtttggctctttcgtggagaaaactgtgatgccttacattagcacaacacca
gctaaactcaggaacccttgcacaaatgaacagaactgcacgagcccatttagctacaaa
aatgtgctcagccttactgataaaggggaagtatttaatgaacttgttggtaagcagcgc
atatctggaaatttggattcaccagaaggtggctttgatgcaatcatgcaagttgcagtt
tgtggatcactgattggttggaggaatgtgacacggctgctggtgttttccacggatgct
gggtttcactttgctggagatgggaaacttggtggcattgttttaccgaatgatggacag
tgtcacctggaaaatgatatgtacacaatgagccattattatgattatccttctattgct
caccttgtccagaaactaagcgaaaataacattcagacaatttttgcagttactgaagaa
tttcagcctgtttacaaggaactgaaaaatttgatccctaagtcagcggtaggaacatta
tctgcaaattccggcaatgtgattcagttgatcatcgatgcgtacaattccctttcttca
gaagtcattttggaaaacagcaaattaccggaaggagtaacgataaattacaagtcttac
tgcaagaatggggtgaatggaacaggggaaaatgggagaaaatgctctaatatttccatt
ggggatgaggttcaatttgaaattagcataactgcaaataaatgtccaaataagaactct
gaaaccattaaaattaagcctctgggcttcactgaggaagtggagattatccttcagttc
atctgtgagtgcgagtgccagagtgaaggcatcccaggaagccccaagtgccacgacggc
aacgggaccttcgagtgtggggcctgcaggtgcaacgaagggcgtgttgggagacactgc
gaatgtagcacggatgaggtgaacagtgaagacatggacgcttactgcaggaaagaaaac
agttcagaaatctgcagcaacaacggagagtgtgtctgtggacagtgtgtgtgtaggaag
agggacaatacaaatgaaatttattctggcaaattctgcgagtgtgataatttcaactgt
gatagatccaatggcttaatatgtggaggaaatggtgtttgcaagtgtcgagtgtgtgag
tgcaaccctaactacaccggcagcgcctgtgactgttctctggacaccacgtcctgcatg
gccgtgaatggacagatctgcaacggccgcggcgtctgcgagtgtggggcctgcaagtgt
acagaccccaagttccaagggccaacctgtgagatgtgtcagacctgccttggagtctgt
gctgagcataaagaatgtgttcagtgccgagccttcaataaaggagaaaagaaagacaca
tgtgctcaggaatgttcacatttcaacattaccaaggttgaaaatcgggacaaattgccc
cagccaggccaggtggatcccttgtcccactgtaaggagaaggacgttgacgactgctgg
ttctacttcacatactcagtgaatgggaacaatgaggccactgttcatgttgtagagact
ccagagtgccccactggcccagacattattccgattgtagcaggtgtggttgctgggatt
gttcttattggccctgcattgctgctgatttggaagcttttaatgatcattcatgacaga
agggaatttgccaaatttgaaaaggaaaaaatgaatgccaaatgggacacgggtgaaaat
cctatttacaagagtgctgtgacaactgttgttaatccgaagtatgagggaaaatga

DBGET integrated database retrieval system