KEGG   Ovis aries (sheep): 443238
Entry
443238            CDS       T03117                                 

Gene name
GHSR
Definition
(RefSeq) growth hormone secretagogue receptor type 1
  KO
K04284  growth hormone secretagogue receptor
Organism
oas  Ovis aries (sheep)
Pathway
oas04024  cAMP signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    443238 (GHSR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    443238 (GHSR)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    443238 (GHSR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:oas04030]
    443238 (GHSR)
G protein-coupled receptors [BR:oas04030]
 Rhodopsin family
  Peptide
   Ghrelin
    443238 (GHSR)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srw 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 443238
NCBI-ProteinID: NP_001009760
Ensembl: ENSOARG00000020744
UniProt: Q8MHZ5
Position
1
AA seq 366 aa
MWNATRSEELGPNLTLPDLDWDAAPDNDSLTDELPPLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWHYRPWNLGDLLCKLFQ
FVSESCTYASVLTITALSVERYFAICFPLRAKVVITKGRVKLVVLAIWAVAFCSAWPIFM
LVGVEHENGTDPRDTNECRATEFAVRSGLLTIMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRSEVVVGASLRDQNHKQTVKMLAVVVFAFVLCWLPFHVGRYLFSKSFEPGSVEIAQI
SQYCNLVSFVLFYFSAAINPILYNIMSKKYRVAVFKLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgtggaatgcgacgcggagcgaggagctggggcccaacctcacgctgccggacctggac
tgggacgctgccccagacaacgactcgctgaccgacgagctgccacccctcttccccgcg
ccgctgctggcgggagtcacagccacctgcgtggcgctcttcgtggtaggcatcgcgggc
aacctgctcaccatgctggtagtgtcacgtttccgcgagctgcgtaccaccactaacctc
tacctgtccagcatggccttctccgacttactcatcttcctctgcatgcccctcgacctc
gtacgcctctggcattaccggccctggaacttgggcgacctgctctgcaaactcttccag
tttgtcagcgagagctgcacctacgcctcggtgctcaccatcaccgcgctgagcgtcgag
cgctacttcgccatctgcttcccgctgcgggccaaggtggtgatcaccaagggccgggtg
aagctcgtcgtcctggccatctgggccgtggctttctgcagcgcctggcccatcttcatg
ctggtcggagtggagcatgagaatggtaccgaccctcgggacactaacgagtgccgcgcc
accgagttcgccgtgcgctccgggctgctcaccatcatggtgtgggtgtccagcatcttc
ttcttcctgcctgttttctgcctcactgtgctctacagcctcatcggcaggaagctatgg
aggagaagacgcagcgaggtggtggtgggcgcctcactcagagaccagaaccacaaacaa
accgtgaagatgctggctgtagtggtttttgctttcgtcctctgctggctgcccttccat
gtaggacgatatttattctccaaatcgttcgagcctggctctgtggagatcgctcagatc
agccaatactgcaacctcgtctctttcgtcctcttctacttcagtgctgctatcaaccct
attctctacaacatcatgtccaagaagtaccgagtggcagtgttcaaacttctgggattt
gaacccttctcccagaggaagctctccactctaaaggatgaaagttctcgggcctggaca
gaatctagtattaatacatga

DBGET integrated database retrieval system