KEGG   Ovis aries (sheep): 443271Help
Entry
443271            CDS       T03117                                 

Gene name
GRIA1
Definition
(RefSeq) glutamate receptor 1 isoform X1
  KO
K05197  glutamate receptor 1
Organism
oas  Ovis aries (sheep)
Pathway
oas04024  cAMP signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04713  Circadian entrainment
oas04720  Long-term potentiation
oas04723  Retrograde endocannabinoid signaling
oas04724  Glutamatergic synapse
oas04728  Dopaminergic synapse
oas04730  Long-term depression
oas05014  Amyotrophic lateral sclerosis (ALS)
oas05031  Amphetamine addiction
oas05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    443271 (GRIA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    443271 (GRIA1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    443271 (GRIA1)
   04728 Dopaminergic synapse
    443271 (GRIA1)
   04720 Long-term potentiation
    443271 (GRIA1)
   04730 Long-term depression
    443271 (GRIA1)
   04723 Retrograde endocannabinoid signaling
    443271 (GRIA1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    443271 (GRIA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    443271 (GRIA1)
  09165 Substance dependence
   05031 Amphetamine addiction
    443271 (GRIA1)
   05033 Nicotine addiction
    443271 (GRIA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oas04040]
    443271 (GRIA1)
Ion channels [BR:oas04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   443271 (GRIA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF659 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 443271
NCBI-ProteinID: XP_004009048
Ensembl: ENSOARG00000009425
UniProt: W5PI48
Position
5
AA seq 906 aa AA seqDB search
MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKW
WYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGASGAGSGENGRVVSHDFPKSMQSIPCMSHSSGMP
LGATGL
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacatttttgccttcttctgcaccggtttcctaggcgcggtagtaggtgccaat
ttccccaacaatatccagatcgggggattatttccaaaccagcagtcacaggaacatgct
gcttttagatttgctttgtcacaactcacagagcccccaaagttgctcccccagattgat
attgtgaacatcagtgacagctttgagatgacctacagattctgttcccagttctctaaa
ggagtctatgccatctttgggttttatgaacgaaggacagtcaacatgctgacctccttc
tgcggggccctccacgtctgcttcattacaccaagctttcccgttgacacatccaaccag
tttgtcctccagctgcgccccgagctgcaggatgccctcatcagtatcatcgaccattac
aagtggcaaaaatttgtctacatttatgatgctgaccggggtctgtctgtcctgcagaaa
gtcctggacacagctgctgagaagaactggcaggtgacagctgtcaacattttgacaacc
acagaggagggttaccggatgctcttccaggacctggagaagaaaaaggagcggctggtg
gtggtggactgtgaatcggaacgcctcaatgctatcctgggccagattgtaaagctggag
aagaatggcattggctaccactatattcttgcaaatctgggtttcatggacattgactta
aacaaattcaaggagagtggagcaaatgtaacaggtttccagttggtgaactacactgat
accatcccggccaagatcatgcaacagtggaaaaacagtgatgctcgggaccacacccgg
gtggactggaagagacctaagtacacctctgcgctcacctacgatggggtgaaggtaatg
gctgaggctttccagagcctgcggaggcagagaatcgatatctcccgccgggggaatgct
ggggactgcctggctaacccagctgtgccctggggccagggcatcgacatccagagagcg
ctgcagcaggtgcggtttgaaggcttgacaggaaatgtgcaatttaatgagaaaggacgg
cggaccaactacaccctccacgtgatcgaaatgaagcatgatggcatccgaaagattggc
tactggaatgaagatgacaaattcgtccctgcagccacagatgctcaagccgggggggat
aactcaagtgtccagaatagaacatacatcgtcaccacaatcctagaagatccttatgtg
atgctcaagaagaatgccaaccagtttgaaggcaatgaccgctacgagggctactgtgtg
gagttggcggcagagattgccaagcatgtgggatattcctaccgtcttgagatcgtcagc
gatggaaaatatggagcccgtgaccctgacacaaaggcttggaatggcatggtgggagag
ctggtctatggaagagcagatgtggccgttgcccctttaactatcaccttggtccgggaa
gaggtgatcgatttctccaagccgtttatgagtctggggatctccatcatgataaaaaag
ccgcagaagtccaagccgggggtcttttccttcctggaccctttggcttacgagatctgg
atgtgcatcgtgttcgcctacattggagtgagcgtcgtccttttcctggtcagccgtttc
agcccctacgaatggcacagcgaagagtttgaggaagggcgggaccagaccaccagcgac
cagtccaatgagtttgggatattcaacagcttgtggttctccctgggagccttcatgcag
caaggatgcgacatctctcccaggtccttgtccggccgcatcgtgggcggcgtctggtgg
ttcttcaccttgatcatcatctcctcctacacagccaacctggccgccttcctgacggtg
gagaggatggtgtctcccatcgagagtgccgaggacctagcaaagcagacggaaatcgct
tacgggaccctggaagcgggatctacgaaggagttcttcaggaggtctaaaattgccgtg
tttgagaagatgtggacgtacatgaagtcagcagagccatccgtgtttgtgcggaccaca
gaggaggggatgatccgagtaaggaaatccaaaggcaaatacgcctaccttctagagtcc
accatgaatgagtacattgagcagcggaaaccctgcgacaccatgaaggtgggaggtaac
ttggattcgaaaggctatggcattgcgacgcccaaggggtccgccctgagaggtcccgta
aacctagcggttttgaaactcagtgagcaaggcgtcttagacaagctgaaaagcaaatgg
tggtacgataaaggggaatgtggaagcaaggactccggaagtaaggacaagacgagtgct
ctcagcctcagcaatgtggcgggcgtgttctacatcctgatcggaggacttggactcgcc
atgctggttgccttaattgagttctgctacaaatcgcgtagcgaatccaagcggatgaag
ggtttctgtttgatcccacagcaatccatcaacgaagccatacggacatcgacgctcccc
cgaaacagtggggcaggagccagcggtgccgggagtggagagaacggccgggtggtcagc
catgacttccccaagtccatgcaatcgatcccctgcatgagccacagttcaggaatgccc
ttgggagccactggattgtaa

DBGET integrated database retrieval system