KEGG   Ovis aries (sheep): 443329Help
Entry
443329            CDS       T03117                                 

Gene name
GH
Definition
(RefSeq) somatotropin precursor
  KO
K05438  growth hormone
Organism
oas  Ovis aries (sheep)
Pathway
oas04060  Cytokine-cytokine receptor interaction
oas04080  Neuroactive ligand-receptor interaction
oas04151  PI3K-Akt signaling pathway
oas04630  Jak-STAT signaling pathway
oas04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    443329 (GH)
   04151 PI3K-Akt signaling pathway
    443329 (GH)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    443329 (GH)
   04060 Cytokine-cytokine receptor interaction
    443329 (GH)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    443329 (GH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oas04052]
    443329 (GH)
Cytokines and growth factors [BR:oas04052]
 Cytokines
  CSF and other factors
   443329 (GH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_1 XTBD
Motif
Other DBs
NCBI-GeneID: 443329
NCBI-ProteinID: NP_001009315
Ensembl: ENSOARG00000013932
UniProt: P67930
Position
11
AA seq 217 aa AA seqDB search
MMAAGPRTSLLLAFTLLCLPWTQVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFER
TYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLS
RVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDVTPRAGQILKQTYDKFDRNMRSDDA
LLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgatggctgcaggcccccggacctccctgctcctggctttcaccctgctctgcctgccc
tggactcaggtggtgggcgccttcccagccatgtccttgtccggcctgtttgccaacgct
gtgctccgggctcagcacctgcatcaactggctgctgacaccttcaaagagtttgagcgc
acctacatcccggagggacagagatactccatccagaacacccaggttgccttctgcttc
tccgaaaccatcccagcccccacgggcaagaatgaggcccagcagaaatcagacttggag
ctgcttcgcatctcactgctccttatccagtcgtggcttgggcccctgcagttcctcagc
agagtcttcaccaacagcctggtgtttggcacctcggaccgtgtctatgagaagctgaag
gacctggaggaaggcatcctggccctgatgcgggagctggaagatgttaccccccgggct
gggcagatcctcaagcagacctatgacaaatttgacagaaacatgcgcagtgatgatgcg
ctgctcaagaactacggtctgctctcctgcttccggaaggacctgcacaagacggagacg
tacctgagggtcatgaagtgtcgccgcttcggggaggccagctgcgccttctag

DBGET integrated database retrieval system