KEGG   Ovis aries (sheep): 443330Help
Entry
443330            CDS       T03117                                 

Gene name
ADORA3
Definition
(RefSeq) adenosine receptor A3
  KO
K04268  adenosine receptor A3
Organism
oas  Ovis aries (sheep)
Pathway
oas04022  cGMP-PKG signaling pathway
oas04071  Sphingolipid signaling pathway
oas04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    443330 (ADORA3)
   04022 cGMP-PKG signaling pathway
    443330 (ADORA3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    443330 (ADORA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:oas04030]
    443330 (ADORA3)
G protein-coupled receptors [BR:oas04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    443330 (ADORA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 443330
NCBI-ProteinID: NP_001009775
Ensembl: ENSOARG00000019630
UniProt: P35342 W5QED6
Position
1
AA seq 317 aa AA seqDB search
MPVNSTAVSWTSVTYITVEILIGLCAIVGNVLVIWVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVISLGVTIHFYSCLFMTCLMLIFTHASIMSLLAIAVDRYLRVKLTVRYRR
VTTQRRIWLALGLCWLVSFLVGLTPMFGWNMKLSSADENLTFLPCRFRSVMRMDYMVYFS
FFLWILVPLVVMCAIYFDIFYIIRNRLSQSFSGSRETGAFYGREFKTAKSLLLVLFLFAL
CWLPLSIINCILYFDGQVPQTVLYLGILLSHANSMMNPIVYAYKIKKFKETYLLILKACV
ICQPSKSMDPSTEQTSE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcaacagcacggctgtgtcctggaccagcgttacctacatcactgtggagatt
ctcatcgggctctgcgccatagtgggcaacgtgctggtcatctgggtggtcaagctgaac
cccagcctgcagaccaccaccttctatttcattgtctccctagccctggctgacattgct
gtcggggtgctggttatgcctctggccattgtcatcagcctgggtgtcacaatccacttt
tatagctgccttttcatgacctgcttgatgctgatattcacccacgcatccatcatgtcc
ttgctagccattgctgtggaccgatacctgcgggtcaagctcacagtcagatacagaaga
gtcaccacgcaaagaagaatatggttggctctgggcctttgctggctggtgtcattcctg
gtgggattgacccccatgtttggctggaacatgaaactgagctcagcagacgaaaacctc
accttcctaccctgccgattccgttcggtcatgaggatggattacatggtctacttcagc
ttcttcctgtggattctcgttcccctggttgtcatgtgcgccatctactttgatatcttc
tacatcatccggaaccgactcagccagagcttttctggctccagagagacaggcgcattc
tatggacgggagttcaagacagccaagtccctgttactggttcttttcttgtttgctttg
tgctggctgcctttgtccatcatcaactgtatcctctactttgatgggcaagtgccgcag
actgtgctgtacctggggatcctgctctcccacgctaactccatgatgaaccccatcgtc
tatgcttacaaaataaagaagttcaaggaaacctatctcttgatcctcaaagcctgtgtg
atctgccagccctctaagtccatggacccaagcactgagcagacttctgagtag

DBGET integrated database retrieval system