KEGG   Ovis aries (sheep): 443342Help
Entry
443342            CDS       T03117                                 

Gene name
IL10
Definition
(RefSeq) interleukin-10 precursor
  KO
K05443  interleukin 10
Organism
oas  Ovis aries (sheep)
Pathway
oas04060  Cytokine-cytokine receptor interaction
oas04068  FoxO signaling pathway
oas04625  C-type lectin receptor signaling pathway
oas04630  Jak-STAT signaling pathway
oas04660  T cell receptor signaling pathway
oas04672  Intestinal immune network for IgA production
oas05133  Pertussis
oas05140  Leishmaniasis
oas05142  Chagas disease (American trypanosomiasis)
oas05143  African trypanosomiasis
oas05144  Malaria
oas05145  Toxoplasmosis
oas05146  Amoebiasis
oas05150  Staphylococcus aureus infection
oas05152  Tuberculosis
oas05310  Asthma
oas05320  Autoimmune thyroid disease
oas05321  Inflammatory bowel disease (IBD)
oas05322  Systemic lupus erythematosus
oas05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    443342 (IL10)
   04068 FoxO signaling pathway
    443342 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    443342 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    443342 (IL10)
   04660 T cell receptor signaling pathway
    443342 (IL10)
   04672 Intestinal immune network for IgA production
    443342 (IL10)
 09160 Human Diseases
  09163 Immune diseases
   05310 Asthma
    443342 (IL10)
   05322 Systemic lupus erythematosus
    443342 (IL10)
   05320 Autoimmune thyroid disease
    443342 (IL10)
   05321 Inflammatory bowel disease (IBD)
    443342 (IL10)
   05330 Allograft rejection
    443342 (IL10)
  09171 Infectious diseases: Bacterial
   05133 Pertussis
    443342 (IL10)
   05150 Staphylococcus aureus infection
    443342 (IL10)
   05152 Tuberculosis
    443342 (IL10)
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    443342 (IL10)
   05144 Malaria
    443342 (IL10)
   05145 Toxoplasmosis
    443342 (IL10)
   05140 Leishmaniasis
    443342 (IL10)
   05142 Chagas disease (American trypanosomiasis)
    443342 (IL10)
   05143 African trypanosomiasis
    443342 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oas04052]
    443342 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:oas00536]
    443342 (IL10)
Cytokines and growth factors [BR:oas04052]
 Cytokines
  Interleukins
   443342 (IL10)
Glycosaminoglycan binding proteins [BR:oas00536]
 Heparan sulfate/Haparin
  Cytokines
   443342 (IL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL10 IL22 TSA
Motif
Other DBs
NCBI-GeneID: 443342
NCBI-ProteinID: NP_001009327
Ensembl: ENSOARG00000006292
UniProt: Q29408
Position
12
AA seq 177 aa AA seqDB search
MPSSSAVLCCLVFLAGVAASRDASTLSDSSCTHFPASLPHMLRDVRAAFGKVKTFFQMKD
QLNSMLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKLKTL
RLRLRRCHRFLPCENKSKAVEQVKRVFNMLQERGVYKAMSEFDIFINYIESYMTTKM
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcagctcagccgtgctctgttgcctggtcttcctggctggggtggcagccagc
cgagatgccagcaccctgtctgacagcagctgtacccacttcccagccagcctgccccac
atgctgcgggacgtccgagctgccttcggcaaagtgaagactttctttcaaatgaaggac
caactgaacagcatgctgttgacccagtctctgctggatgactttaagggttacctgggt
tgccaagccttgtcggaaatgatccagttttacctggaggaggtgatgccacaggctgag
aaccatgggcctgacatcaaggagcacgtgaactcgctgggggagaagctgaagaccctc
cggctgcggctgcggcgctgtcatcgttttctgccctgcgaaaacaagagcaaggcggtg
gagcaggtgaagagagtcttcaatatgctccaagagaggggtgtctacaaagccatgagt
gagtttgacatcttcatcaactacatagaatcctacatgacaacgaagatgtaa

DBGET integrated database retrieval system