KEGG   Ovis aries (sheep): 443370Help
Entry
443370            CDS       T03117                                 

Gene name
POU1F1
Definition
(RefSeq) pituitary-specific positive transcription factor 1
  KO
K09363  POU domain transcription factor, class 1
Organism
oas  Ovis aries (sheep)
Brite
KEGG Orthology (KO) [BR:oas00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    443370 (POU1F1)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Helix-turn-helix
   POU domain factors
    443370 (POU1F1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pou Homeodomain Homeobox_KN HnRNPA1
Motif
Other DBs
NCBI-GeneID: 443370
NCBI-ProteinID: NP_001009350
Ensembl: ENSOARG00000017058
UniProt: P79364
Position
1
AA seq 291 aa AA seqDB search
MSCQPFTSTDTFIPLNSESSATLPLIMHPSAAECLPVSNHATNVMSTATGLHYSVPSCHY
GNQSSTYGVMAGSLTPCLYEFPDHTLSHGFPPMHQPLLSEDPTAADFKQELRRKSKLIEE
PIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSF
KNACKLKAILFKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPS
SQEILRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFPNSKEHLECR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgagttgccaaccttttacttcgactgatacctttatacctctgaattctgagtcttct
gcaactctgcctctgataatgcatcccagtgctgcggagtgcctaccggtctccaaccac
gccaccaacgtgatgtccacagcaacaggacttcattattctgttccttcctgtcattac
ggaaaccagtcatcgacctatggcgtgatggcagggagcttaaccccttgtctttatgag
tttcctgaccacacgctgagtcatggttttcctcccatgcatcagcctctcctttcagag
gatcccactgccgctgatttcaagcaggagctcaggcggaaaagcaaattgattgaagag
ccaatagacatggattctccagaaattcgagaacttgaaaagtttgccaatgagtttaaa
gtgagaagaattaagctaggatacacccagacaaatgttggggaagctctggcagctgtg
catggctctgaattcagtcaaacaactatctgccgatttgaaaacctgcagctcagcttc
aagaatgcatgcaaactaaaagcaatattattcaaatggctggaggaagctgagcaagta
ggagctttatacaatgagaaagttggtgcaaatgaaagaaaaaggaaacggagaacaact
atcagtattgctgctaaagacgccctggagagacactttggagaacagaataagccttcc
tctcaggagatcctgaggatggctgaagaactaaacctggagaaagaagtggtgagggtt
tggttttgtaaccgaagacagagagaaaaacgagtgaaaacaagcctgaatcagagttta
tttcctaattccaaggagcatctcgaatgcagataa

DBGET integrated database retrieval system