KEGG   Ovis aries (sheep): 443418Help
Entry
443418            CDS       T03117                                 

Gene name
CXCL8
Definition
(RefSeq) interleukin-8 precursor
  KO
K10030  interleukin 8
Organism
oas  Ovis aries (sheep)
Pathway
oas04060  Cytokine-cytokine receptor interaction
oas04061  Viral protein interaction with cytokine and cytokine receptor
oas04062  Chemokine signaling pathway
oas04064  NF-kappa B signaling pathway
oas04072  Phospholipase D signaling pathway
oas04218  Cellular senescence
oas04620  Toll-like receptor signaling pathway
oas04621  NOD-like receptor signaling pathway
oas04622  RIG-I-like receptor signaling pathway
oas04657  IL-17 signaling pathway
oas04932  Non-alcoholic fatty liver disease (NAFLD)
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas05132  Salmonella infection
oas05133  Pertussis
oas05134  Legionellosis
oas05135  Yersinia infection
oas05142  Chagas disease (American trypanosomiasis)
oas05144  Malaria
oas05146  Amoebiasis
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05164  Influenza A
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05200  Pathways in cancer
oas05202  Transcriptional misregulation in cancer
oas05219  Bladder cancer
oas05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    443418 (CXCL8)
   04072 Phospholipase D signaling pathway
    443418 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    443418 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    443418 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    443418 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    443418 (CXCL8)
   04621 NOD-like receptor signaling pathway
    443418 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    443418 (CXCL8)
   04657 IL-17 signaling pathway
    443418 (CXCL8)
   04062 Chemokine signaling pathway
    443418 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    443418 (CXCL8)
   05202 Transcriptional misregulation in cancer
    443418 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    443418 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    443418 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    443418 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    443418 (CXCL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    443418 (CXCL8)
   05135 Yersinia infection
    443418 (CXCL8)
   05133 Pertussis
    443418 (CXCL8)
   05134 Legionellosis
    443418 (CXCL8)
  09172 Infectious disease: viral
   05164 Influenza A
    443418 (CXCL8)
   05161 Hepatitis B
    443418 (CXCL8)
   05163 Human cytomegalovirus infection
    443418 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    443418 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    443418 (CXCL8)
   05144 Malaria
    443418 (CXCL8)
   05142 Chagas disease (American trypanosomiasis)
    443418 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oas04052]
    443418 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:oas00536]
    443418 (CXCL8)
Cytokines and growth factors [BR:oas04052]
 Cytokines
  Chemokines
   443418 (CXCL8)
Glycosaminoglycan binding proteins [BR:oas00536]
 Heparan sulfate/Haparin
  Chemokines
   443418 (CXCL8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 443418
NCBI-ProteinID: NP_001009401
Ensembl: ENSOARG00000014496
UniProt: P36925 S5TPE2
Position
6
AA seq 101 aa AA seqDB search
MTSKLAVALLAAFLLSAALCEAAVLSRMSTELRCQCIKTHSTPFHPKFIKELRVIESGPH
CENSEIIVKLTNGKEVCLDPKEKWVQKVVQAFLKRAEKQDP
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgacttccaagctggctgttgctctcttggccgctttcctgctctctgcagctctgtgt
gaagctgcagttctgtcaagaatgagtacagaacttcgatgccaatgcataaaaacacat
tccacacctttccaccccaaatttatcaaagaactgagagttattgagagtgggccacac
tgcgaaaattcagaaatcattgttaagcttaccaacggaaaagaggtgtgcttagacccc
aaggaaaagtgggtgcagaaggttgtgcaggcatttttgaagagagctgagaagcaagat
ccatga

DBGET integrated database retrieval system