KEGG   Ovis aries (sheep): 443431Help
Entry
443431            CDS       T03117                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor isoform X1
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas04010  MAPK signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04022  cGMP-PKG signaling pathway
oas04066  HIF-1 signaling pathway
oas04068  FoxO signaling pathway
oas04072  Phospholipase D signaling pathway
oas04150  mTOR signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04152  AMPK signaling pathway
oas04211  Longevity regulating pathway
oas04213  Longevity regulating pathway - multiple species
oas04520  Adherens junction
oas04910  Insulin signaling pathway
oas04913  Ovarian steroidogenesis
oas04923  Regulation of lipolysis in adipocytes
oas04930  Type II diabetes mellitus
oas04931  Insulin resistance
oas04932  Non-alcoholic fatty liver disease (NAFLD)
oas04960  Aldosterone-regulated sodium reabsorption
Module
oas_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    443431 (INSR)
   04015 Rap1 signaling pathway
    443431 (INSR)
   04010 MAPK signaling pathway
    443431 (INSR)
   04066 HIF-1 signaling pathway
    443431 (INSR)
   04068 FoxO signaling pathway
    443431 (INSR)
   04072 Phospholipase D signaling pathway
    443431 (INSR)
   04022 cGMP - PKG signaling pathway
    443431 (INSR)
   04151 PI3K-Akt signaling pathway
    443431 (INSR)
   04152 AMPK signaling pathway
    443431 (INSR)
   04150 mTOR signaling pathway
    443431 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    443431 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    443431 (INSR)
   04923 Regulation of lipolysis in adipocyte
    443431 (INSR)
   04913 Ovarian Steroidogenesis
    443431 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    443431 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    443431 (INSR)
   04213 Longevity regulating pathway - multiple species
    443431 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    443431 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    443431 (INSR)
   04931 Insulin resistance
    443431 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    443431 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:oas04090]
    443431 (INSR)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     443431 (INSR)
Protein kinases [BR:oas01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   443431 (INSR)
CD molecules [BR:oas04090]
 Proteins
  443431 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 443431
NCBI-ProteinID: XP_004008598
Ensembl: ENSOARG00000000285
UniProt: W5NQ38
Position
5
AA seq 1382 aa AA seqDB search
MGAGGGSGAAAVLLLVVVAALLVGAAGHLYPGEVCPGMDIRNNLTRLHELANCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYSLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTSEGLCCHSECL
GNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHNKCKTSRRQG
CHQYVIHNNKCVPECPSGYTMNSSNLMCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC
TIINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL
EIGNYSFYALDNQNLRQLWDWGKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSYIRTSYDKILLKWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPTRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWE
RQAEDSELYELDYCLKGLKLPSRTWSPPFESEGSQKHNQSEYEESAGECCSCPKTDSQIL
KELEESSFRKTFEDYLHNVVFIPRKSSSGPVAEDARPSRKRRALGDVGNVTAAVPTVLGF
PNSSSTSTPTSSEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDSPEERCSVAAYV
SARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGEEELHLCV
SRRHYAVERGCRLRGLLPGNYSVRVRATSLAGNGSWTEATYFYVTDYLDVPSNIAKIIIG
PLIFVFLFSVVIGSICLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPR
EKITLLRELGQGSFGMVYEGNARDIVKGEAETRVAVKTVNESASLRERIEFLNEASVMKG
FTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMA
AEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPV
RWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDN
CPERVTDLMRMCWQFNPKMRPTFLEIVDLLKDDLHPSFPEVSFFHSEENKAPESEELEME
FEDMESVPLDRSSHAQREEAGVRDGGSALGLKRNYDEHIPYTHMNGGKKNGRILTLPRSN
PS
NT seq 4149 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccgggggcgggagcggggcggcagccgtgctgctgctggtggtcgtcgccgcg
ctgctggtgggcgccgcgggccacctgtaccctggagaagtgtgccccggtatggatatc
cggaataatctcacccggctgcatgagctggccaactgctcggtcattgaaggacatttg
cagattctgttgatgttcaaaacgagacctgaggacttccgagacctcagtttccccaaa
ctcatcatgatcactgattacttgctgctcttccgggtctatgggctggagagcctgaag
gacttgttccccaacctcacggtcatccgaggctcgcgcctcttctttaattatgcactg
gtcatctttgagatggttcacctgaaggagcttggcctctacagcctgatgaacatcacc
cgggggtctgtccgcatcgagaagaacaatgaactctgctacctggccaccatcgactgg
tctcgaatcctggattccgtggaggataattacatcgtgctgaacaaagacgacaatgag
gagtgtggggacatttgtccaggcaccgccaagggcaagaccaactgccctgccactgtc
atcaacgggcagtttgtggagcggtgctggacacacagccactgccagaaagtgtgtccg
actatctgtaagtcacatggctgcacctctgagggtctctgctgccacagcgagtgcttg
ggcaactgctcagagcccgacgaccccaccaagtgcgtggcctgtcgcaacttctacctg
gacggcaggtgcgtggagacctgcccgcccccttactaccacttccaagactggcgctgc
gtgaacttcagcttctgccaggacctgcacaacaaatgcaagacctctcggaggcaaggc
tgccaccagtatgtcattcacaacaacaagtgcgtccccgagtgcccctctggctacacg
atgaattctagcaacttgatgtgtaccccttgcctgggcccctgtcccaaggtgtgccac
ctcctggaaggtgagaagaccatcgattcagtgacatctgcccaggagcttcgaggctgc
accatcatcaacggaagcttaatcatcaacattcgagggggcaacaacctggcagctgag
ctagaggccaaccttggactcattgaagaaatttcaggatatctgaaaatccgccggtcc
tatgccctggtgtcactttccttcttccggaagttacgtctgattcgaggggagaccttg
gaaattgggaactactctttctacgccttggacaaccagaacctaaggcagctatgggac
tggggcaaacacaacctcaccatcactcaggggaaactcttcttccactataaccccaaa
ctgtgcctgtcggaaattcacaagatggaggaagtttcaggaaccaaggggcgccaggag
agaaatgacattgctctaaagaccaatggggaccaggcatcctgtgaaaatgaattactt
aaattttcttacattcggacatcttatgacaagatcttgctgaaatgggagccgtattgg
cctcctgacttccgagacctcctggggttcatgttgttctacaaagaggccccttaccag
aatgtgacagaatttgatgggcaggatgcgtgtggctccaacagctggacagtggtggat
attgacccgcctacaaggtccaacgaccccaagtcacagaaccatcctgggtggctgatg
cgtggtctcaagccctggacccagtatgccatctttgtcaagaccctggtcaccttttct
gatgaacgccgtacatacggagccaagagtgacatcatctatgtccagacagacgccact
aatccttccgtccccctggatcccatctcagtttctaattcctcgtcccagattattctg
aagtggaagcctccctccgaccccaatggcaatatcacacactacttggtgttctgggag
aggcaggcggaagatagtgagctgtatgaactggattattgcctcaaagggttgaagctg
ccctcccggacctggtctccaccgttcgagtcggaggggtcccagaagcacaaccagagt
gagtatgaggagtctgctggcgaatgctgctcctgcccgaagaccgactctcagatcctc
aaggagctggaggagtcctcgttcaggaaaacgtttgaagattacctgcacaacgtggtt
ttcatccccagaaaatcatcttcaggccctgttgccgaggacgctaggccttcgaggaaa
cgcagagcccttggtgacgtggggaatgtgacagcagccgtgcccactgttctggggttc
cccaatagctcctccaccagcacacccacaagctcagaggagcacagacccttcgagaaa
gtggtgaacaaggagtcgctggtcatctccggcctgcgtcactttactgggtatcgcatt
gagcttcaggcttgcaaccaagattcccccgaggagaggtgtagcgtggctgcctatgtc
agcgccaggaccatgcctgaagccaaggcagatgatattgtcggccccgtgacccatgaa
atcttcgagaacaacgtcgttcacttgatgtggcaggagcccaaggaacccaacggtctg
attgtgctgtatgaagtgagttaccgacgatatggcgaggaggagctgcacctctgcgtc
tcccgccggcattatgctgtggagcgcggctgccggctgcgcgggctgctgcctgggaat
tacagcgtgcgagttcgggctacctccctggcaggcaatgggtcttggacggaagccacc
tacttctacgtgacagactatttagacgtgccatcaaatattgcaaagatcatcatcggt
cccctcatctttgtctttctcttcagtgttgtgattggaagtatttgtctattcctgaga
aagaggcagccagatgggccactgggaccattgtatgcttcttcaaacccagagtacctc
agtgccagcgatgtgttcccatgctctgtgtatgtgccggacgagtgggaggtgcctcga
gagaagatcacgctcctgcgagaactgggtcaaggctccttcggcatggtgtacgagggc
aacgccagggacattgtcaagggtgaggcggagacccgcgtggcagtgaagacggtcaac
gagtcggccagcctgcgagagcggatcgagtttctcaacgaggcttcggtcatgaagggc
ttcacctgccaccatgtggtccgcctcctgggggtggtgtccaaaggccagccaacgctg
gtggtgatggagttgatggctcacggagacctgaagagttacctccgttccctgcggcct
gaggctgagaataaccccggccgccctccccctaccctgcaagaaatgattcagatggcg
gcagagatcgccgatgggatggcatacctgaacgctaagaagttcgtgcaccgggatctt
gcagcccggaactgcatggttgcccacgactttaccgtcaaaattggagacttcggaatg
acaagagacatctatgaaacggattactaccggaaagggggcaaaggtctgctccccgtg
cggtggatggcacctgaatccctcaaggacggagtcttcaccacctcttcagacatgtgg
tctttcggtgtggtcctttgggaaattaccagcttggctgaacagccttaccaaggtcta
tcaaatgagcaggtgctgaaatttgtcatggatggagggtacctggatcaacctgacaat
tgtccagagagagtcaccgacctgatgcggatgtgctggcagttcaaccccaagatgcgt
ccaaccttcctggagatcgtggacctgctcaaggatgacctgcaccccagctttcccgaa
gtgtccttcttccacagcgaggagaacaaggcgcccgagagcgaggagctggaaatggag
tttgaggacatggagagcgtgcccctggaccggtcctcgcacgcgcagagagaggaggcc
ggggtccgggacggagggtcggcgctggggctaaagcgaaactatgacgagcacatcccc
tatacccacatgaacgggggcaagaaaaacggacggattctgactttgccccggtcaaat
ccttcctaa

DBGET integrated database retrieval system