KEGG   Ovis aries (sheep): 443472
Entry
443472            CDS       T03117                                 

Gene name
IL12B
Definition
(RefSeq) interleukin-12 subunit beta precursor
  KO
K05425  interleukin 12B
Organism
oas  Ovis aries (sheep)
Pathway
oas04060  Cytokine-cytokine receptor interaction
oas04620  Toll-like receptor signaling pathway
oas04622  RIG-I-like receptor signaling pathway
oas04625  C-type lectin receptor signaling pathway
oas04630  JAK-STAT signaling pathway
oas04658  Th1 and Th2 cell differentiation
oas04940  Type I diabetes mellitus
oas05133  Pertussis
oas05134  Legionellosis
oas05140  Leishmaniasis
oas05142  Chagas disease
oas05143  African trypanosomiasis
oas05145  Toxoplasmosis
oas05146  Amoebiasis
oas05152  Tuberculosis
oas05162  Measles
oas05164  Influenza A
oas05168  Herpes simplex virus 1 infection
oas05171  Coronavirus disease - COVID-19
oas05200  Pathways in cancer
oas05205  Proteoglycans in cancer
oas05321  Inflammatory bowel disease
oas05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    443472 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    443472 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    443472 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    443472 (IL12B)
   04625 C-type lectin receptor signaling pathway
    443472 (IL12B)
   04658 Th1 and Th2 cell differentiation
    443472 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    443472 (IL12B)
   05205 Proteoglycans in cancer
    443472 (IL12B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    443472 (IL12B)
   05164 Influenza A
    443472 (IL12B)
   05162 Measles
    443472 (IL12B)
   05168 Herpes simplex virus 1 infection
    443472 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    443472 (IL12B)
   05134 Legionellosis
    443472 (IL12B)
   05152 Tuberculosis
    443472 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    443472 (IL12B)
   05145 Toxoplasmosis
    443472 (IL12B)
   05140 Leishmaniasis
    443472 (IL12B)
   05142 Chagas disease
    443472 (IL12B)
   05143 African trypanosomiasis
    443472 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    443472 (IL12B)
   05330 Allograft rejection
    443472 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    443472 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oas04052]
    443472 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:oas00536]
    443472 (IL12B)
Cytokines and growth factors [BR:oas04052]
 Cytokines
  Interleukins
   443472 (IL12B)
Glycosaminoglycan binding proteins [BR:oas00536]
 Heparan sulfate / Heparin
  Cytokines
   443472 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_5 Ig_4 Ig_3 fn3 Ig_2 I-set
Other DBs
NCBI-GeneID: 443472
NCBI-ProteinID: NP_001009438
Ensembl: ENSOARG00000013146
UniProt: P68220
Position
5
AA seq 327 aa
MHPQQLVVSWFSLVLLASPIVAIWELEKNVYVVELDWYPNAPGETVVLTCDTPEEDGITW
TSDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSRSLLLLHKKEDGIWSTDILKDQ
KEPKAKSFLKCEAKDYSGHFTCSWLTAISTNLKFSVKSSRGSSDPRGVTCGAASLSAEKV
SMDHREYNKYTVECQEGSACPAAEESLPIEVVMEAVHKLKYENYTSSFFIRDIIKPDPPK
NLQLRPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKNKREKKLFTDQTSAKVTCH
KDANIRVQARDRYYSSFWSEWASVSCS
NT seq 984 nt   +upstreamnt  +downstreamnt
atgcaccctcagcagttggtcgtttcctggttttccctggttttgctggcatcgcccatc
gtggccatatgggaactggagaaaaatgtttatgttgtagaattggattggtatcctaat
gctcctggagaaacagtggtcctcacgtgtgacactcctgaagaagacggcatcacctgg
acctcagaccagagcagtgaggtcctgggctctggcaaaaccttgaccatccaagtcaaa
gagtttggagatgctgggcagtacacctgtcacaaaggaggcgaggttctgagtcgttca
ctcctcctgctgcacaaaaaggaagatggaatttggtccactgatattttaaaggatcag
aaagaacccaaagctaagagttttttaaaatgtgaggcaaaggattattctggacacttc
acctgctcgtggctgacagcaatcagtactaatctgaaattcagtgtcaaaagcagcaga
ggctcctctgacccccgaggggtgacgtgcggagcagcgtccctctcagcagagaaggtc
agcatggaccacagggagtataacaagtacacagtggagtgtcaggagggcagtgcctgc
ccggccgccgaggagagcctgcccattgaggtcgtgatggaagctgtgcacaagctcaag
tatgaaaactacaccagcagcttcttcatcagggacatcatcaaaccagacccacccaag
aacctgcaactgagaccactaaagaattctcggcaggtggaagtcagctgggagtaccct
gacacgtggagcaccccacattcctacttctccctgacgttttgtgttcaggtccaggga
aagaacaagagagaaaagaaactcttcacagaccaaacctcagccaaagtcacatgccac
aaggatgccaacatccgcgtgcaagcccgggaccgctactacagctcattctggagtgaa
tgggcatctgtgtcctgcagttag

DBGET integrated database retrieval system