KEGG   Ovis aries (sheep): 554322Help
Entry
554322            CDS       T03117                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 proprotein isoform X2
  KO
K13376  transforming growth factor beta-2
Organism
oas  Ovis aries (sheep)
Pathway
oas04010  MAPK signaling pathway
oas04060  Cytokine-cytokine receptor interaction
oas04068  FoxO signaling pathway
oas04110  Cell cycle
oas04218  Cellular senescence
oas04350  TGF-beta signaling pathway
oas04380  Osteoclast differentiation
oas04390  Hippo signaling pathway
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas05140  Leishmaniasis
oas05142  Chagas disease (American trypanosomiasis)
oas05144  Malaria
oas05145  Toxoplasmosis
oas05146  Amoebiasis
oas05152  Tuberculosis
oas05161  Hepatitis B
oas05166  Human T-cell leukemia virus 1 infection
oas05200  Pathways in cancer
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05210  Colorectal cancer
oas05211  Renal cell carcinoma
oas05212  Pancreatic cancer
oas05220  Chronic myeloid leukemia
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05321  Inflammatory bowel disease (IBD)
oas05323  Rheumatoid arthritis
oas05410  Hypertrophic cardiomyopathy (HCM)
oas05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    554322 (TGFB2)
   04350 TGF-beta signaling pathway
    554322 (TGFB2)
   04390 Hippo signaling pathway
    554322 (TGFB2)
   04068 FoxO signaling pathway
    554322 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    554322 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    554322 (TGFB2)
   04218 Cellular senescence
    554322 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    554322 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    554322 (TGFB2)
   05206 MicroRNAs in cancer
    554322 (TGFB2)
   05205 Proteoglycans in cancer
    554322 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    554322 (TGFB2)
   05212 Pancreatic cancer
    554322 (TGFB2)
   05225 Hepatocellular carcinoma
    554322 (TGFB2)
   05226 Gastric cancer
    554322 (TGFB2)
   05220 Chronic myeloid leukemia
    554322 (TGFB2)
   05211 Renal cell carcinoma
    554322 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    554322 (TGFB2)
   05321 Inflammatory bowel disease (IBD)
    554322 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    554322 (TGFB2)
   05414 Dilated cardiomyopathy (DCM)
    554322 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    554322 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    554322 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    554322 (TGFB2)
   05161 Hepatitis B
    554322 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    554322 (TGFB2)
   05144 Malaria
    554322 (TGFB2)
   05145 Toxoplasmosis
    554322 (TGFB2)
   05140 Leishmaniasis
    554322 (TGFB2)
   05142 Chagas disease (American trypanosomiasis)
    554322 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oas04052]
    554322 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:oas00536]
    554322 (TGFB2)
Cytokines and growth factors [BR:oas04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   554322 (TGFB2)
Glycosaminoglycan binding proteins [BR:oas00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   554322 (TGFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 554322
NCBI-ProteinID: XP_004013650
Ensembl: ENSOARG00000011583
Position
12
AA seq 414 aa AA seqDB search
MHYCVLSAFLLLHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPSFLPSENAIPP
TFYRPYFRIVRFDVSSMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSP
TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKSPHLLLMLLPSYRLESQQSNRRK
KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH
SRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcactactgtgtgttgagcgcgtttctgctcctgcatctggtcacggtcgcgctcagc
ctgtctacctgcagcacgctcgacatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccagaagactaccccgaaccc
gaggaggtccccccggaggtgatctccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgtgagcgcgagcggagcgacgaggaatactacgcc
aaggaggtttacaaaatagacatgccgtccttcttaccctcggaaaatgccatcccgccc
actttctacagaccgtactttagaattgtccgatttgacgtctcctcgatggagaagaat
gcttccaatttggtgaaggccgagttcagagtctttcgtttacagaacccgaaagccaga
gtgcctgaacaacggattgagctgtatcagattctcaaatccaaagatttaacatctcca
acccagcgctacatcgacagcaaagttgtgaaaaccagagcagagggcgaatggctctcc
tttgacgtcaccgatgctgttcacgaatggctccaccataaagacaggaacctgggattt
aaaataagtttacactgtccctgctgcacctttgtaccatcgaataattacatcatcccc
aataaaagtgaagaactagaagcacgatttgcaggtattgatggcacctctacctatacc
agtggtgatcagaaaacaataaagtccactaggaaaaaaaacagtgggaagagcccacat
ctcctgctaatgttgttgccctcctacagacttgagtcccaacagtccaaccggcggaag
aagcgtgctctggacgcagcctattgctttagaaatgtgcaggataattgttgcctacgc
ccactttacattgatttcaagagggatcttgggtggaaatggattcatgagcctaaaggg
tacaatgccaacttctgtgctggagcatgcccatatctgtggagctcagacactcagcac
agtagggttctcagcttatataataccataaatccagaagcgtctgcttccccttgctgc
gtgtcccaagatttagagccgctcaccattctctactacattggcaaaacacccaagatc
gaacagctttctaatatgattgtcaagtcttgcaaatgcagctaa

DBGET integrated database retrieval system