KEGG   Ovis aries (sheep): 808252Help
Entry
808252            CDS       T03117                                 

Gene name
COX2
Definition
(RefSeq) cytochrome c oxidase subunit II
  KO
K02261  cytochrome c oxidase subunit 2
Organism
oas  Ovis aries (sheep)
Pathway
oas00190  Oxidative phosphorylation
oas01100  Metabolic pathways
oas04260  Cardiac muscle contraction
oas04714  Thermogenesis
oas04932  Non-alcoholic fatty liver disease (NAFLD)
oas05010  Alzheimer disease
oas05012  Parkinson disease
oas05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    808252 (COX2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    808252 (COX2)
  09159 Environmental adaptation
   04714 Thermogenesis
    808252 (COX2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    808252 (COX2)
   05012 Parkinson disease
    808252 (COX2)
   05016 Huntington disease
    808252 (COX2)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    808252 (COX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:oas03029]
    808252 (COX2)
Mitochondrial biogenesis [BR:oas03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Cytochrome c oxidase
    808252 (COX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX2 COX2_TM
Motif
Other DBs
NCBI-GeneID: 808252
NCBI-ProteinID: NP_008409
UniProt: O78750 A0A0E3LZY8
Position
MT
AA seq 227 aa AA seqDB search
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE
VETIWTILPAIILIMIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDS
YMIPTSELKPGELRLLEVDNRVVLPMEMTVRMLISSEDVLPSWAVPSLGLKTDAIPGRLN
QTTLMSTRPGLFYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcccatacaactaggctttcaagacgcaacatcacctatcatggaagaacta
ctacactttcacgaccacacattaataatcgttttcctaatcagctctctagtactttat
attatttcactaatactaacaacaaaattaacccataccagtaccatagacgcgcaagaa
gtagaaacaatctgaaccattctaccagccattatcttaattatgattgctcttccatcc
ttgcgaatcctatacataatagatgaaatcaacaacccatctctcacagtaaagaccata
gggcatcaatgatactgaagctatgaatatacagattatgaagacctaagcttcgattcc
tatataatcccaacatcagaactaaaaccaggagaactgcgtttactagaagtagacaac
cgagttgtattacccatggaaataacagtccgaatactaatctcttccgaagatgtccta
ccctcatgagcagtcccttctctaggactaaaaacagacgcaattccaggtcgtttaaat
caaacaacccttatgtcaactcgtccaggcctattctacggtcaatgctcagaaatttgc
ggatcaaatcacagttttatgccaattgttcttgaactagtcccattaaaatactttgaa
aaatgatccgcatcaatactataa

DBGET integrated database retrieval system